Property Summary

NCBI Gene PubMed Count 23
PubMed Score 37.36
PubTator Score 16.05

Knowledge Summary

Patent (5,795)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.300 5.4e-06
Astrocytoma, Pilocytic -1.300 4.9e-05
atypical teratoid / rhabdoid tumor -1.400 4.0e-05
glioblastoma -1.700 7.8e-07
lung adenocarcinoma -3.100 4.8e-09
lung cancer -4.100 4.7e-05
medulloblastoma, large-cell -1.400 2.3e-03
non-small cell lung cancer -3.386 3.5e-30
osteosarcoma 1.062 4.7e-05
ovarian cancer 1.100 5.6e-10
posterior fossa group A ependymoma -1.200 1.8e-05
psoriasis -1.800 1.4e-115
subependymal giant cell astrocytoma -2.421 3.0e-02

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MAVPARTCGASRPGPARTARPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGASAYSFPQQHTM      1 - 70
QHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADA     71 - 140
AENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNKVNYSYAAVQI    141 - 210
PTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRP    211 - 280
WYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANV    281 - 350
RNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT    351 - 420
VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYE    421 - 490
DALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLL    491 - 560
HPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQIRTLVKSLDERYIDEVTRNYTWVPI    561 - 630
RSTNYSLGLVLPPYSTFYLQANLSDQILQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDN    631 - 700
NTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVF    701 - 770
PNKAAEDWTENPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGRRTLRPA    771 - 840
VVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQ    841 - 910
VGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFVPTVADFLNLAWWTSAAAWS    911 - 980
LFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNT    981 - 1050
NLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSL   1051 - 1120
GVLVSLQLLLLLGLPPRPQPQVLVHASRRL                                           1121 - 1150
//

Text Mined References (29)

PMID Year Title