Property Summary

NCBI Gene PubMed Count 18
PubMed Score 81.00
PubTator Score 25.78

Knowledge Summary

Patent (1,366)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 3.2e-03
posterior fossa group B ependymoma -2.000 3.2e-11
glioblastoma -2.500 1.2e-07
medulloblastoma -2.200 8.6e-09
atypical teratoid / rhabdoid tumor -1.700 2.3e-05
medulloblastoma, large-cell -2.100 1.2e-04
primitive neuroectodermal tumor -1.500 1.5e-02
pediatric high grade glioma -2.200 2.0e-07
pilocytic astrocytoma -1.700 7.0e-05
subependymal giant cell astrocytoma -1.196 2.9e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
504425 confirmatory 2 / 0 / 2 Mode of action assay-Specificity dose response assay for the identification of selective inhibitors of T-type calcium subunit Cav3.2 in the Cav3.3 expressing cell line on automated patch clamp

Gene RIF (8)

PMID Text
25454347 Extracellular pressure increases [Ca(2+)]i via Cav3.3, driving a PKC-beta- IKK- IkB-NF-kB pathway that stimulates cancer cell proliferation
23488970 Ethanol primarily affects the CaV3.2 isoform of T-type Ca(2)+ channels, acting through protein kinase C.
18591418 The sodium channel toxins tetrodotoxin and saxitoxin interact with the alpha-subunit of T-type Ca 2+ channels.
17535809 two distinct regions of the Cav3.3 channel are necessary and sufficient for complete M1 receptor-mediated channel inhibition
16939858 Observational study of gene-disease association. (HuGE Navigator)
16740636 CatSper1 and CatSper2 can associate with and modulate the function of the Ca(v)3.3 channel, which might be important in the regulation of sperm function.
15254077 intracellular regions after repeats I and IV play a role in gating interdependently, suggesting a direct interaction, and splice variation of Cav3.3 channels provides a mechanism for fine-tuning latency and duration of low-threshold spikes.
11927664 Specific contribution of human T-type calcium channel isotypes (alpha(1G), alpha(1H) and alpha(1I)) to neuronal excitability.

AA Sequence

MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPIAFFCLRQTTSPRN      1 - 70
WCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIF     71 - 140
GKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLG    141 - 210
NVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGC    211 - 280
HEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVI    281 - 350
FQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL    351 - 420
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPHAKEPRHYHGK    421 - 490
TKGQGDEGRHLGSRHCQTLHGPASPGNDHSGRELCPQHSPLDATPHTLVQPIPATLASDPASCPCCQHED    491 - 560
GRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGARSSEDGASSELGKEEEEEEQADGAVWLCGDVWRETR    561 - 630
AKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYL    631 - 700
RNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLM    701 - 770
LFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL    771 - 840
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDSSGDPKLCPIPMTP    841 - 910
NGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGR    911 - 980
SAAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEVAADEGPPRAAPLHTPHAHHIHHGPHLAHRH    981 - 1050
RHHRRTLSLDNRDSVDLAELVPAVGAHPRAAWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDRGEDEE   1051 - 1120
EIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALE   1121 - 1190
RPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLA   1191 - 1260
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKG   1261 - 1330
KFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPV   1331 - 1400
TNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYY   1401 - 1470
ATYCHTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVA   1471 - 1540
FGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLD   1541 - 1610
TVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW   1611 - 1680
NGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEL   1681 - 1750
ELEMAHGLGPGPRLPTGSPGAPGRGPGGAGGGGDTEGGLCRRCYSPAQENLWLDSVSLIIKDSLEGELTI   1751 - 1820
IDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGE   1821 - 1890
LDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASSPLLPM   1891 - 1960
PAEFFHPAVSASQKGPEKGTGTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQT   1961 - 2030
TLEDSLTLSDSPRRALGPPAPAPGPRAGLSPAARRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHH   2031 - 2100
DSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPAPGLTPARKFSSTSSLAAPGRPHAAAL   2101 - 2170
AHGLARSPSWAADRSKDPPGRAPLPMGLGPLAPPPQPLPGELEPGDAASKRKR                    2171 - 2223
//

Text Mined References (19)

PMID Year Title
25454347 2015 Increased extracellular pressure stimulates tumor proliferation by a mechanosensitive calcium channel and PKC-?.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23488970 2013 Ethanol inhibition of a T-type Ca²+ channel through activity of protein kinase C.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22883433 2012 Genome-wide association study implicates HLA-C*01:02 as a risk factor at the major histocompatibility complex locus in schizophrenia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18591418 2008 Differential interactions of Na+ channel toxins with T-type Ca2+ channels.
17535809 2007 Selective inhibition of Cav3.3 T-type calcium channels by Galphaq/11-coupled muscarinic acetylcholine receptors.
16939858 2006 CACNA1I is not associated with childhood absence epilepsy in the Chinese Han population.
16740636 2006 Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity.
16382099 2005 International Union of Pharmacology. XLVIII. Nomenclature and structure-function relationships of voltage-gated calcium channels.
15254077 2004 Functional impact of alternative splicing of human T-type Cav3.3 calcium channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080115 2002 Cloning and expression of the human T-type channel Ca(v)3.3: insights into prepulse facilitation.
11927664 2002 Specific contribution of human T-type calcium channel isotypes (alpha(1G), alpha(1H) and alpha(1I)) to neuronal excitability.
10749850 2000 Specific properties of T-type calcium channels generated by the human alpha 1I subunit.
10591208 1999 The DNA sequence of human chromosome 22.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
10454147 1999 Structure and alternative splicing of the gene encoding alpha1I, a human brain T calcium channel alpha1 subunit.