Property Summary

Ligand Count 36
NCBI Gene PubMed Count 75
PubMed Score 273.23
PubTator Score 106.13

Knowledge Summary

Patent (5,888)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Refractive error 50 0.0 3.0
Type 2 diabetes mellitus 272 0.0 1.2
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0
Disease Target Count Z-score Confidence
Conn's syndrome 22 5.545 2.8
Hypertension 396 3.192 1.6
Parkinson's disease 392 3.191 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 8.7e-03
atypical teratoid / rhabdoid tumor -1.900 4.8e-10
ductal carcinoma in situ 1.300 2.0e-02
ependymoma -1.100 2.6e-02
glioblastoma -1.200 5.4e-03
group 3 medulloblastoma -1.500 9.4e-05
interstitial cystitis -1.300 4.8e-04
intraductal papillary-mucinous carcinoma... 1.300 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.0e-02
invasive ductal carcinoma 1.700 1.3e-02
lung adenocarcinoma -1.200 2.5e-07
lung cancer -3.600 1.3e-05
lung carcinoma 2.500 5.4e-25
medulloblastoma, large-cell -2.100 1.1e-06
non-small cell lung cancer -1.108 1.0e-14
osteosarcoma -1.016 5.7e-04
primitive neuroectodermal tumor -1.500 1.8e-02

Protein-protein Interaction (4)

Gene RIF (54)

AA Sequence

MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAARQAKAAQTMS      1 - 70
TSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANC     71 - 140
VALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLF    141 - 210
SVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLF    211 - 280
VIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNF    281 - 350
AFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG    351 - 420
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVSGEGENRGCCG    421 - 490
SLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANK    491 - 560
VLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVT    561 - 630
RHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ    631 - 700
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAE    701 - 770
EKERKKIARKESLENKKNNKPEVNQIANSDNKVTIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVP    771 - 840
AGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIR    841 - 910
SHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVV    911 - 980
KILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKS    981 - 1050
NPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGP   1051 - 1120
IYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIP   1121 - 1190
KNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFK   1191 - 1260
PKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESENVPVPTATPGNSEESNRISITFFRLFRVMRLVKLL   1261 - 1330
SRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLF   1331 - 1400
RCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYL   1401 - 1470
TRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNS   1471 - 1540
DGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATF   1541 - 1610
LIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFK   1611 - 1680
RNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQV   1681 - 1750
PTSTNANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSSVKRTRYYETYIRSDSGDEQL   1751 - 1820
PTICREDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNIDSERPRGYHHPQGF   1821 - 1890
LEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMA   1891 - 1960
VAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPD   1961 - 2030
ISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEME   2031 - 2100
SAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL            2101 - 2161
//

Text Mined References (81)

PMID Year Title