Property Summary

NCBI Gene PubMed Count 24
PubMed Score 20.89
PubTator Score 20.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.200 2.0e-03
ependymoma -1.400 3.7e-03
group 3 medulloblastoma -1.200 1.1e-02
head and neck cancer and chronic obstruc... -1.400 9.3e-03
lung adenocarcinoma 1.300 4.1e-06
lung cancer 2.800 1.7e-03
lung carcinoma 1.100 8.3e-13
malignant mesothelioma -4.100 2.0e-06
non-small cell lung cancer 1.637 8.1e-11
oligodendroglioma -1.300 3.9e-03
osteosarcoma -1.433 7.0e-04
ovarian cancer 1.300 1.3e-08
pituitary cancer -1.900 8.9e-06
psoriasis -1.700 2.4e-04

Gene RIF (11)

AA Sequence

MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKW      1 - 70
SEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGL     71 - 140
SSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVP    141 - 210
SSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVT    211 - 280
LQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEK    281 - 350
TTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE    351 - 420
VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGES    421 - 490
TAE                                                                       491 - 493
//

Text Mined References (26)

PMID Year Title