Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.14
PubTator Score 20.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -4.100 2.0e-06
astrocytic glioma -1.200 2.0e-03
ependymoma -1.400 3.7e-03
oligodendroglioma -1.300 3.9e-03
psoriasis -1.700 2.4e-04
osteosarcoma -1.433 7.0e-04
non-small cell lung cancer 1.653 3.9e-12
lung cancer 2.800 1.7e-03
lung adenocarcinoma 1.300 4.1e-06
group 3 medulloblastoma -1.200 1.1e-02
lung carcinoma 1.100 8.3e-13
ovarian cancer 1.300 1.3e-08
pituitary cancer -1.900 8.9e-06
head and neck cancer and chronic obstruc... -1.400 9.3e-03

Gene RIF (9)

PMID Text
24362251 Short hairpin RNA-mediated knockdown of CABYR-a/b significantly inhibited the proliferation of NCI-H460 and A549 cells and resulted in the attenuation of Akt phosphorylation, which is constitutively active in lung cancer cells.
22285430 CABYR-c is highly expressed in hepatocellular carcinoma tissues and may play an oncogenic role in heptocarcinogenesis as well as its progression.
21274509 High CABYR is associated with neoplasms.
21240291 CABYR variants form a complex not only with the scaffolding protein AKAP3 but also with another RII-like domain-containing protein in the sperm fibrous sheath.
20954286 The expression of NF-kappaB was not significantly affected by silencing CABYR in 293T cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16139264 splice variants containing CR-B are expressed during spermiogenesis and assemble into the fibrous sheath of the principal piece; however, calcium binding occurs only to those CABYR isoforms containing CABYR-A
15752768 Northern blot showed that CABYR transcripts were expressed more distinctly in the fetal brain than in the adult brain, suggesting that this protein may play a role during brain development.
11820818 sequencing, cloning, expression and characterization

AA Sequence

MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKW      1 - 70
SEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGL     71 - 140
SSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVP    141 - 210
SSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVT    211 - 280
LQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEK    281 - 350
TTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE    351 - 420
VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGES    421 - 490
TAE                                                                       491 - 493
//

Text Mined References (24)

PMID Year Title
24362251 2014 Knockdown of CABYR-a/b increases chemosensitivity of human non-small cell lung cancer cells through inactivation of Akt.
22285430 2012 The expression and effects the CABYR-c transcript of CABYR gene in hepatocellular carcinoma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21274509 2011 Expression of the sperm fibrous sheath protein CABYR in human cancers and identification of ?-enolase as an interacting partner of CABYR-a.
21240291 2011 CABYR binds to AKAP3 and Ropporin in the human sperm fibrous sheath.
20954286 2010 CABYR RNAi plasmid construction and NF-?B signal transduction pathway.
20731842 2010 CABYR isoforms expressed in late steps of spermiogenesis bind with AKAPs and ropporin in mouse sperm fibrous sheath.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17317841 2007 CABYR is a novel cancer-testis antigen in lung cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16139264 2005 Translation and assembly of CABYR coding region B in fibrous sheath and restriction of calcium binding to coding region A.
15752768 2005 Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11820818 2002 CABYR, a novel calcium-binding tyrosine phosphorylation-regulated fibrous sheath protein involved in capacitation.
11730911 2002 Novel signaling pathways involved in sperm acquisition of fertilizing capacity.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7849610 1994 The cytoskeleton of mammalian spermatozoa.