Property Summary

NCBI Gene PubMed Count 8
PubMed Score 37.51
PubTator Score 13.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 36 4.759 2.4

Expression

Gene RIF (2)

AA Sequence

MAEDGLPKIYSHPPTESSKTPTAATIFFGADNAIPKSETTITSEGDHVTSVNEYMLESDFSTTTDNKLTA      1 - 70
KKEKLKSEDDMGTDFIKSTTHLQKEITSLTGTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIA     71 - 140
KEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVPADEAVQVTDS    141 - 210
TIPEAEIPPAPEESFTTIPDITALEEEKITEIDLSVLEDDTSAVATLTDSDEKFITVFELTTSAEKDKDK    211 - 280
REDTLLTDEETTEGASIWMERDTANEAETHSVLLTAVESRYDFVVPASIATNLVEESSTEEDLSETDNTE    281 - 350
TVPKITEPFSGTTSVLDTPDYKEDTSTTETDIFELLKEEPDEFMI                             351 - 395
//

Text Mined References (10)

PMID Year Title