Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.25
PubTator Score 5.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 3.4e-02
atypical teratoid / rhabdoid tumor -1.400 2.7e-03
group 3 medulloblastoma 3.100 5.0e-03
lung adenocarcinoma 2.500 1.8e-03
lung carcinoma 1.900 9.2e-24
osteosarcoma -2.228 2.3e-07

Gene RIF (3)

AA Sequence

MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPN      1 - 70
EVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDT     71 - 140
FCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKSLICAFAIAFIISVMLIAANQVL    141 - 210
RSGMK                                                                     211 - 215
//

Text Mined References (7)

PMID Year Title