Property Summary

NCBI Gene PubMed Count 21
PubMed Score 34.88
PubTator Score 37.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.100 2.3e-04
astrocytic glioma -2.600 1.7e-03
Astrocytoma, Pilocytic -2.800 5.1e-07
atypical teratoid / rhabdoid tumor -4.100 5.2e-10
Down syndrome -1.200 1.4e-03
ependymoma -2.900 1.4e-03
glioblastoma -3.100 1.5e-09
group 3 medulloblastoma -3.700 4.7e-04
medulloblastoma, large-cell -4.800 3.4e-06
oligodendroglioma -2.100 1.0e-02
Pick disease -1.500 8.8e-03
pituitary cancer 1.900 2.6e-04
primitive neuroectodermal tumor -4.300 1.5e-07
psoriasis -1.200 6.5e-03
subependymal giant cell astrocytoma -2.691 4.4e-02

Gene RIF (13)

AA Sequence

MGGGDGAAFKRPGDGARLQRVLGLGSRREPRSLPAGGPAPRRTAPPPPGHASAGPAAMSSHIAKSESKTS      1 - 70
LLKAAAAAASGGSRAPRHGPARDPGLPSRRLPGSCPATPQSSGDPSSRRPLCRPAPREEGARGSQRVLPQ     71 - 140
AHCRPREALPAAASRPSPSSPLPPARGRDGEERGLSPALGLRGSLRARGRGDSVPAAASEADPFLHRLRP    141 - 210
MLSSAFGQDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGH    211 - 280
VDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRD    281 - 350
VDLNGDGRVDFEEFVRMMSR                                                      351 - 370
//

Text Mined References (28)

PMID Year Title