Property Summary

NCBI Gene PubMed Count 41
PubMed Score 14.07
PubTator Score 18.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26695862 CABLES1 is a critical regulator of corticotrope proliferation that defines a pathway often inactivated in Cushing disease
25361894 Results illuminated a dynamic regulatory system through which activated Akt and 14-3-3 work directly together to neutralize a potent tumor suppressor function of Cables1.
24975575 the results suggest Cables1 as a novel p21 regulator through maintaining p21 stability and support the model that the tumor-suppressive function of Cables1 occurs at least in part through enhancing the tumor-suppressive activity of p21.
23333304 HIV-1 Vif upregulates the expression of Cdk5 and Abl enzyme substrate 1 (CABLES1) in Vif-expression T cells
21890215 The results did not detect a significant association. It indicated that common genetic variations in CDK5 genes might not play a role in the genetic predisposition to autism.
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
18059193 Mechanisms of CABLES1 gene inactivation in ovarian cancer development are reported.
17982127 Loss of Cables expression in 65% of CRCs suggests that it is a common event in colonic carcinogenesis, with promoter methylation and LOH appearing to be important mechanisms of Cables gene inactivation.
16177568 Analysis of the RT-PCR prducts of the CABLES1 gene showed eight intragenic deletions in its mRNA transcripts; 5/8 are the result of RNA splicing.

AA Sequence

MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPEPPRKPRMDPRRRQAALSFLT      1 - 70
NISLDGRLPPQDAEWGGGEEGGAAKPGAGGACGARTRFSLLAAAERGGCIALAAPGTPAAGLAAGSGPCL     71 - 140
PQPSSLPPLIPGGHATVSGPGVARGFASPLGAGRASGEQWQPPRPAPLAACAQLQLLDGSGAAGQEELEE    141 - 210
DDAFISVQVPAAAFLGSGTPGSGSGSRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQR    211 - 280
SRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSI    281 - 350
FSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTS    351 - 420
SFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVK    421 - 490
PSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRK    491 - 560
LCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLV    561 - 630
QSS                                                                       631 - 633
//

Text Mined References (47)

PMID Year Title
26695862 2016 The Cables1 Gene in Glucocorticoid Regulation of Pituitary Corticotrope Growth and Cushing Disease.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25361894 2015 Cables1 complex couples survival signaling to the cell death machinery.
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24975575 2015 Cables1 controls p21/Cip1 protein stability by antagonizing proteasome subunit alpha type 3.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21890215 2011 No association of polymorphisms in the CDK5, NDEL1, and LIS1 with autism in Chinese Han population.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
20559324 2010 Cables1 protects p63 from proteasomal degradation to ensure deletion of cells after genotoxic stress.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18059193 2008 Mechanisms of Cables 1 gene inactivation in human ovarian cancer development.
17982127 2007 The Cables gene on chromosome 18q is silenced by promoter hypermethylation and allelic loss in human colorectal cancer.
17101133 2006 NESH (Abi-3) is present in the Abi/WAVE complex but does not promote c-Abl-mediated phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16177568 2005 Aberrant splicing of cables gene, a CDK regulator, in human cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729625 2004 Loss of cables, a cyclin-dependent kinase regulatory protein, is associated with the development of endometrial hyperplasia and endometrial cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14637168 2003 ik3-2, a relative to ik3-1/Cables, is involved in both p53-mediated and p53-independent apoptotic pathways.
13679449 2003 Loss of cables, a novel gene on chromosome 18q, in ovarian cancer.
12612882 2003 Loss of cables protein expression in human non-small cell lung cancer: a tissue microarray study.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11955625 2002 ik3-2, a relative to ik3-1/cables, is associated with cdk3, cdk5, and c-abl.
11733001 2001 ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3).
11706030 2002 Differential effect of ik3-1/cables on p53- and p73-induced cell death.
11585773 2001 Cables enhances cdk2 tyrosine 15 phosphorylation by Wee1, inhibits cell growth, and is lost in many human colon and squamous cancers.
11527406 2001 ik3-1/Cables is associated with Trap and Pctaire2.
10896159 2000 Cables links Cdk5 and c-Abl and facilitates Cdk5 tyrosine phosphorylation, kinase upregulation, and neurite outgrowth.
10873625 2000 Molecular cloning of a cyclin-like protein associated with cyclin-dependent kinase 3 (cdk 3) in vivo.