Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.07
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
posterior fossa group B ependymoma 2.200 3.1e-13
psoriasis -1.400 2.9e-21
osteosarcoma 1.985 2.7e-02
glioblastoma -2.400 2.2e-05
atypical teratoid / rhabdoid tumor -1.600 5.2e-05
medulloblastoma -1.400 2.2e-03
medulloblastoma, large-cell -3.000 4.7e-07
adrenocortical carcinoma -3.018 2.3e-08
non-small cell lung cancer -2.828 7.1e-33
intraductal papillary-mucinous adenoma (... -1.300 1.9e-02
intraductal papillary-mucinous carcinoma... -1.900 3.3e-03
colon cancer -1.300 4.2e-02
lung cancer -1.600 5.8e-04
breast carcinoma -1.100 7.1e-06
interstitial cystitis -2.100 2.4e-05
lung adenocarcinoma -2.300 7.9e-20
adult high grade glioma -2.100 8.0e-04
Breast cancer -2.300 4.8e-13
lung carcinoma -1.200 2.8e-08
spina bifida -2.128 4.2e-02
ovarian cancer -2.600 7.8e-12
pituitary cancer 2.400 1.7e-06

Synonym

Accession Q9H9S4 Q5TAW6 Q6WG71 Q96FG1 Q9BZ33
Symbols MO2L
MO25-BETA
bA103J18.3

Gene

PANTHER Protein Class (2)

PDB

3ZHP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (5)

PMID Text
26306467 Frameshift Mutations of CAB39L are associated with Gastric and Colorectal Cancers.
23135622 In conclusion, our current results provide new evidence that MLAA-34 may be a novel anti-apoptotic factor in vitro, and the data presented here show a strong correlation between anti-apoptosis with the upregulation of MLAA-34.
21240483 our data indicate that MLAA-34 may be used as a prognostic marker for treatment decision-making in acute monocytic leukemia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18592235 It was proposed that a splice variant MLAA-34 of CAB39L associated with acute monocytic leukemia. MLAA-34 was identified and characterized. Identification and functional characterization of the novel acute monocytic leukemia associated antigen MLAA-34

AA Sequence

MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA      1 - 70
QELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL     71 - 140
RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF    141 - 210
EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF    211 - 280
VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP                 281 - 337
//

Text Mined References (18)

PMID Year Title
26306467 2016 Frameshift Mutations of CAB39L, an Activator of LKB1 Tumor Suppressor, in Gastric and Colorectal Cancers.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23135622 2013 The expression and functional characterization associated with cell apoptosis and proteomic analysis of the novel gene MLAA-34 in U937 cells.
21269460 2011 Initial characterization of the human central proteome.
21240483 2011 Quantitative assessment of MLAA-34 expression in diagnosis and prognosis of acute monocytic leukemia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18592235 2009 Identification and functional characterization of the novel acute monocytic leukemia associated antigen MLAA-34.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15755502 2005 Serological identification of immunogenic antigens in acute monocytic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.