| Tbio | Calcium-binding protein 39-like |
Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).
Comments
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2798 | 7.1e-33 |
| psoriasis | 6685 | 2.9e-21 |
| lung adenocarcinoma | 2714 | 7.9e-20 |
| posterior fossa group B ependymoma | 1530 | 3.1e-13 |
| Breast cancer | 3098 | 4.8e-13 |
| ovarian cancer | 8491 | 7.8e-12 |
| adrenocortical carcinoma | 1427 | 2.3e-08 |
| lung carcinoma | 2844 | 2.8e-08 |
| medulloblastoma, large-cell | 6234 | 4.7e-07 |
| pituitary cancer | 1972 | 1.7e-06 |
| breast carcinoma | 1614 | 7.1e-06 |
| glioblastoma | 5572 | 2.2e-05 |
| interstitial cystitis | 2299 | 2.4e-05 |
| atypical teratoid / rhabdoid tumor | 4369 | 5.2e-05 |
| lung cancer | 4473 | 5.8e-04 |
| adult high grade glioma | 2148 | 8.0e-04 |
| medulloblastoma | 1524 | 2.2e-03 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 3.3e-03 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 1.9e-02 |
| osteosarcoma | 7933 | 2.7e-02 |
| colon cancer | 1475 | 4.2e-02 |
| spina bifida | 1064 | 4.2e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Acute monocytic leukemia | 11 | 3.168 | 1.6 |
| Peutz-Jeghers syndrome | 23 | 3.001 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| posterior fossa group B ependymoma | 2.200 | 3.1e-13 |
| psoriasis | -1.400 | 2.9e-21 |
| osteosarcoma | 1.985 | 2.7e-02 |
| glioblastoma | -2.400 | 2.2e-05 |
| atypical teratoid / rhabdoid tumor | -1.600 | 5.2e-05 |
| medulloblastoma | -1.400 | 2.2e-03 |
| medulloblastoma, large-cell | -3.000 | 4.7e-07 |
| adrenocortical carcinoma | -3.018 | 2.3e-08 |
| non-small cell lung cancer | -2.828 | 7.1e-33 |
| intraductal papillary-mucinous adenoma (... | -1.300 | 1.9e-02 |
| intraductal papillary-mucinous carcinoma... | -1.900 | 3.3e-03 |
| colon cancer | -1.300 | 4.2e-02 |
| lung cancer | -1.600 | 5.8e-04 |
| breast carcinoma | -1.100 | 7.1e-06 |
| interstitial cystitis | -2.100 | 2.4e-05 |
| lung adenocarcinoma | -2.300 | 7.9e-20 |
| adult high grade glioma | -2.100 | 8.0e-04 |
| Breast cancer | -2.300 | 4.8e-13 |
| lung carcinoma | -1.200 | 2.8e-08 |
| spina bifida | -2.128 | 4.2e-02 |
| ovarian cancer | -2.600 | 7.8e-12 |
| pituitary cancer | 2.400 | 1.7e-06 |
| PMID | Text | |
|---|---|---|
| 26306467 | Frameshift Mutations of CAB39L are associated with Gastric and Colorectal Cancers. | |
| 23135622 | In conclusion, our current results provide new evidence that MLAA-34 may be a novel anti-apoptotic factor in vitro, and the data presented here show a strong correlation between anti-apoptosis with the upregulation of MLAA-34. | |
| 21240483 | our data indicate that MLAA-34 may be used as a prognostic marker for treatment decision-making in acute monocytic leukemia | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 18592235 | It was proposed that a splice variant MLAA-34 of CAB39L associated with acute monocytic leukemia. MLAA-34 was identified and characterized. Identification and functional characterization of the novel acute monocytic leukemia associated antigen MLAA-34 |
MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA 1 - 70 QELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL 71 - 140 RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF 141 - 210 EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF 211 - 280 VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP 281 - 337 //
| PMID | Year | Title | |
|---|---|---|---|
| 26306467 | 2016 | Frameshift Mutations of CAB39L, an Activator of LKB1 Tumor Suppressor, in Gastric and Colorectal Cancers. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. | |
| 23135622 | 2013 | The expression and functional characterization associated with cell apoptosis and proteomic analysis of the novel gene MLAA-34 in U937 cells. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 21240483 | 2011 | Quantitative assessment of MLAA-34 expression in diagnosis and prognosis of acute monocytic leukemia. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 18592235 | 2009 | Identification and functional characterization of the novel acute monocytic leukemia associated antigen MLAA-34. | |
| 17353931 | 2007 | Large-scale mapping of human protein-protein interactions by mass spectrometry. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 16054041 | 2005 | AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism. | |
| 15755502 | 2005 | Serological identification of immunogenic antigens in acute monocytic leukemia. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15057823 | 2004 | The DNA sequence and analysis of human chromosome 13. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12601173 | 2003 | Immunomic analysis of human sarcoma. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 8889548 | 1996 | Normalization and subtraction: two approaches to facilitate gene discovery. |
