Property Summary

NCBI Gene PubMed Count 34
PubMed Score 37.92
PubTator Score 16.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 3.8e-06
group 4 medulloblastoma 1.200 3.3e-02
hereditary spastic paraplegia -1.337 9.7e-03
medulloblastoma, large-cell -1.200 2.5e-05
osteosarcoma -1.232 1.1e-03
ovarian cancer -1.900 6.2e-06
ulcerative colitis -1.100 1.6e-05
Waldenstrons macroglobulinemia 1.173 5.1e-03

Synonym

Accession Q9Y376 A8K8L7
Symbols MO25
CGI-66

Gene

PANTHER Protein Class (2)

PDB

4O27   1UPK   1UPL   2WTK   3GNI   4FZA   4FZD   4FZF   4NZW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (9)

AA Sequence

MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL      1 - 70
AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA     71 - 140
LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF    141 - 210
FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV    211 - 280
FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA             281 - 341
//

Text Mined References (37)

PMID Year Title