Property Summary

NCBI Gene PubMed Count 230
PubMed Score 948.45
PubTator Score 820.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (11)

Gene RIF (211)

PMID Text
26794023 The intrinsic thermodynamic parameters of compound binding to CA IX helped to draw the compound structure to thermodynamics relationship.
26648580 We used cobalt chloride (CoCl2) as a hypoxia-mimetic agent and found that the expression of HIF-1a protein, CA IX mRNA and protein, is effectively upregulated, except for HIF-1a mRNA.
26648507 Flow cytometrically sorted CA9+ population showed increased mRNA level of a Wnt signaling factor AXIN2. In conclusion, these observations indicate that CA9 expression in normal crypt base cells has association with intestinal epithelial stemness
26553365 We conclude that CA9/miR34 interplay shares in the hypoxic regulation of mammospheres and therefore, may play a relevant role in the hypoxic breast cancer stem cell niche.
26522624 We have developed an efficient system for the production of the catalytic domain of CA IX in methylotrophic yeast Pichia pastoris
26510737 In neuroblastoma cells, CAIX and PGK1 expression is up regulated under hypoxia and correlates with response to targeted anti-proliferative treatment.
26337752 Knockdown of CAIX significantly reduced proliferation of cancer cells, suggesting that rapid efflux of lactate and H(+), as enhanced by CAIX, contributes to cancer cell survival under hypoxic conditions.
26259239 Data indicate that carbonic anhydrase IX (CAIX) inhibition as a relevant therapeutic goal in breast cancer, targeting the migratory, invasive, and metastatic potential of this disease.
26252502 Inhibition of CA9 expression or activity resulted in radiation sensitization of RCC in a preclinical mouse model.
26249175 CAIX expression is increased in hypoxia to compensate for the decrease in its activity produced by a low extracellular pH. A major function of CAIX is to lower the extracellular pH.
26138037 Urinary CAIX has a high sensitivity and specificity for diagnosing urothelial bladder cancer.
26130414 our study showed that the expression of CAIX in oral squamous cell carcinoma (OSCC) samples can predict the progression of OSCC and survival of OSCC patients in Taiwan
26026587 we aimed to determine the effect of immunohistochemical staining of ezrin, carbonic anhydrase IX (CA IX), and neuropilin-2 on the prognosis of patients diagnosed with metastatic RCC who were treated with TKIs between January 2007 and June 2012.
25963717 A strong positive correlation between the mRNA expression levels of HIF-2alpha, CA9, VEGF, GLUT-1 and OPN suggests a specific hypoxia-associated profile of mRNA expression in glioblastoma multiforme
25890268 The ZEB1-CA9 signaling axis as a biomarker of poor prognosis in tongue cancer.
25862852 These results suggest that the CA IX-inhibition antibody chKM4927 has an anti-tumor effect in the VMRC-RCW xenograft model via an ADCC-independent mechanism.
25793203 Preventing carbonic anhydrase IX association with 45 S rDNA gene promoters.
25755787 CA9 overexpression was related to histologic differentiation and an independent good prognostic factor in intrahepatic cholangiocarcinoma
25738958 expression of the CA-IX protein is a crucial predictor of poor prognosis in resectable hepatocellular carcinoma
25603870 CAIX serum level was significantly higher in patients with lung cancer than that in the healthy group.
25577552 data indicate that CA9 expression is a poor prognostic factor in resectable hepatocellular carcinoma (HCC) patients
25434612 Results of the present study suggest that radiolabeled Affibody molecules are promising probes for imaging of CAIX-expression in vivo.
25431204 Our results indicate that strong and diffuse CA IX expression may be useful for differentiating ccRCC from several clear cell tumours, with the exception of clear cell breast carcinoma, haemangioblastoma, and clear cell hidradenoma.
25426861 Low CAIX expression most likely indicates poor prognosis in renal cell carcinoma patients. Moreover, low CAIX expression was significantly associated with unfavorable clinicopathological factors.
25422154 High CAIX mRNA expression was significantly associated with poor survival in patients with basal-like, luminal B and triple-negative breast
25377659 CAIX high expression was associated with poor prognosis in nasopharyngeal carcinoma patients.
25374230 High carbonic anhydrase IX expression in stromal cells is associated with invasiveness in gastric cancer.
25230982 we showed that G250 treatment is effective against HT-29 colorectal carcinoma xenografts that differ from RCC by more heterogeneous, hypoxia-related expression of CA
25130478 CA IX is expressed in B-cell lymphomas and is qualitatively correlated with extracellular acidosis in xenograft tumor models.
25117006 Studies indicate that carbonic anhydrase IX (CA IX) can become a clinically useful anticancer target.
25031713 This is the first evidence that CA IX may promote nasopharyngeal carcinoma metastasis
24926090 CAIX can be a useful ancillary marker for identifying mesothelial cells. There is no difference in CAIX expression between benign and malignant mesothelium. Caution should be exercised while evaluating for metastasis from renal cell carcinoma.
24893880 CA9 expression in CNB specimens is a useful marker for predicting chemosensitivity, and CA9 expression in resected tissue is prognostic of DFS in patients with resectable early-stage breast cancer
24886661 These findings suggest that carnosine could be a promising anticancer drug through its ability to attenuate the activity of CA IX
24821582 CA9 levels increase with VEGF-targeted therapy in metastatic renal cell carcinoma.
24745019 The results of GLUT-1 and CAIX expression did not reveal any significant differences between the proteins expression in the primary tumor and the clinicopathological features
24737069 In esophageal cancer, CA IX-expressing tumor stroma is associated with shorter survival.
24695043 Plasma levels of CAIX in oral cancer patients were associated with clinical stages after adjusting for age and areca nut chewing.
24518567 brought the first experimental evidence for the crosstalk between RET and HIF-1 that can explain the increased expression of CAIX in medullary thyroid carcinoma
24471939 Nevertheless, our data support the potential use of therapeutics targeting CAIX in patients with advanced mesothelioma
24436269 carbonic anhydrase IX (CA IX) expression on 1,551 cases of tumors and normal tissues from various organs was evaluated
24349364 The rs1048638 polymorphic genotypes of CA9 might contribute to the prediction of susceptibility to and pathological development of UCC.
24217923 CA9 expression in small intestinal carcinomas was not an independent prognostic factor
24146383 The demonstration of CAIX as a functional mediator of cancer progression provides a biological rationale for its use as a cancer-specific, clinically relevant therapeutic target
24146382 The use of CAIX expression as an attractive and promising candidate marker for systemic anticancer therapy is also discussed
24146381 CA IX expression in many types of tumors indicates its relevance as a general marker of tumor hypoxia
24111817 CAIX staining has no important role in the detection of high-grade CIN in cervical biopsies.
24068505 Used phage display to obatin a VHH nanobody which recognized the expressed CAIX in the HeLa cell lines with high selectivity and specificity.
24008660 in oral squamous cell carcinoma cohort, below-median Ki67 and top-quartile sCAIX expression (Ki67(lo)sCAIX(hi)) were associated with significantly worse disease-specific survival in univariate and multivariate analyses
23957700 cases of carcinoma in situ tended to be CA IX positive
23910904 A critical role for re-oxygenation on CAIX and CAXII levels that may select for an aggressive lung cancer phenotype.
23869833 Studied the correlation between CA IX expression and selected morphological and biological indicators in breast cancer.
23860929 Molecular fluorescence imaging with carbonic anhydrase IX -IRDye800CW can be successfully used to detect hypoxic DCIS before and during surgery to facilitate radical resection
23802595 Carbon anhydrase IX specific immune responses in patients with metastatic renal cell carcinoma potentially cured by interleukin-2 based immunotherapy.
23656776 The stromal CA IX leads to extracellular acidification, in turn enhancing cancer-associated fibroblasts MMP-2 and MMP-9 activation and engaging EMT in cancer cells.
23512428 CA IX levels are elevated in gastric cancer and indicate a poorer prognosis.
23503645 Carbonic anhydrase IX is not useful for discriminating between pleural epithelioid mesotheliomas and renal cell carcinomas
23391777 CA-IX appears to be involved in tumor progression and may be diagnostically useful in cases of endocervical adenocarcinoma and its precursors
23372804 Peroxisome proliferator activated receptor-alpha/hypoxia inducible factor-1alpha interplay sustains carbonic anhydrase IX and apoliprotein E expression in breast cancer stem cells.
23299542 High levels of CA-IX expression is associated with mucinous adenocarcinoma with gastric phenotype.
23291973 The focal adhesion pathway is significantly inhibited in the absence of CA9.
23263636 Our results showed that a combination of hypoxic markers is more robust than a single marker for predicting survival in high-grade glioma.
23226559 The haplotype of rs2071676, rs3829078, and rs1048638 of CA9 combined has potential predictive significance in oral carcinogenesis.
23226406 CA IX as a marker of tumor hypoxia based on a near-infrared (NIR) fluorescent derivative, is reported.
23208505 CAIX is a critical mediator of the expansion of breast cancer stem cells in hypoxic niches by sustaining the mesenchymal and stemness phenotypes of these cells.
23141780 Data indicate that results from the renal cancer global evaluation trial (TARGET) study did not find carbonic anhydrase IX (CAIX) expression status to be either predictive of clinical benefit for treatment with sorafenib.
23098453 High carbonic anhydrase IX expression is associated with vulvar squamous cell carcinoma.
23074198 CAIX is an independent prognostic factor for poor outcome in patients with glioblastoma
22976806 These data suggest that elevated CA IX protein in TNBC is associated with a BRCA1 mutant signature and loss of BRCA1 function.
22918393 CA9, osteopontin and CRP were univariately prognostic for overall survival (OS).
22843905 panel consisting of moderate/strong expression of CA IX, positive HIF-1alpha expression and negative/weak GLUT-1 expression in operative samples and negative/weak ezrin expression in biopsies was associated with 47.5-fold risk of death from this disease
22699808 The combined high expression CA9 and VEGF phenotypewas significantly associated with increased resistance to chemotherapy and poor overall survival in ovarian high-grade serous carcinoma
22486898 Tumors in stages I-II showed 52.6% positivity;in advanced stages, percentage reached 95.5%. As to CA-IX expression and survival, patients with strong tumor staining had lower average survival time than patients with negative or weak-moderate staining.
22484976 Expression of pSTAT3 correlates with Her-2 status and CAIX expression and is associated with tumor progression and worse outcome in esophageal cancer
22465027 MDA-MB-231 breast cancer cells express CAIX in response to hypoxia. We compared CAIX activity associated with membrane ghosts isolated from hypoxic cells with that in intact hypoxic cells.
22436629 Carbonic anhydrase IX is expressed at significantly higher levels in neuroblastomas from patients with adverse clinicopathologic and biologic factors
22430125 these findings identify DKK-1 as a potential factor in the regulation of CA9(carbonic anhydrase IX) cellular homeostasis and also suggest a new possible role for DKK1-1 in tumorigenesis
22367930 High carbonic anhydrase IX expression is associated with malignant pleural effusion.
22366443 High stromal carbonic anhydrase IX expression is linked with significantly reduced overall survival in oral cavity squamous cell carcinoma
22289741 Pharmacologic interference of CAIX catalytic activity using monoclonal antibodies or CAIX-specific small molecule inhibitors, consequently disrupting pH regulation by cancer cells, has been shown recently to impair primary tumor growth and metastasis.
22199327 Carbonic anhydrase IX, hypoxia-inducible factor-1alpha, ezrin and glucose transporter-1 have roles in disease outcome in rectal cancer
22175902 genitourinary or adrenal tumours that can have a clear cell appearance express CAIX
22170054 CA IX actively contributes to cell migration via its ability to facilitate ion transport and pH control at protruding fronts of moving cells.
22147747 Data suggest BAY 79-4620 for the treatment of cancer patients with CAIX overexpressing tumors.
22133596 This study demonistrated that positive correlations between high hypoxic score, obtained CA9 and CXCR4 expression, and main pathological data of poor prognosis, including higher tumour grade, size and N1 status and reduced patients' survival.
22037869 Data show that carbonic anhydrase IX (CA IX) activity was modulated chiefly by the intracellular domain where Thr443 is located.
21959110 Studies indicate that HIF-1alpha, CAIX and VEGF were expressed in OSCC.
21910893 Results show carbonic anhydrase 9 (mRNA and protein), and HIF-1alpha protein are overexpressed in a significant portion of WTs.
21870331 both MCT1 and CD147, but not MCT4, were associated with GLUT1 and CAIX expression in a large series of invasive breast carcinoma samples
21761968 Carbonic anhydrase IX, which is virtually absent in normal brain, is significantly upregulated in craniopharyngiomas and shows a significant association with cyst size.
21745383 Elevated serum levels of the invasion markers TIMP-1 and CAIX in metastatic breast cancer are prognostic markers and are associated with the presence of circulating tumor cells
21694464 Studies indicate that 48 biomarkers have been identified for ccRCC patients, only CD44, CA9, p53, Ki67 and PCNA have shown prognostic value, and IMP-3 and VEGF-R2 are predictors of survival of pRCC patients.
21691815 Carbonic anhydrase IX is overexpressed in a substantial proportion of mucinous and endometrioid ovarian carcinomas and connected to poor patient outcome
21664839 Results indicate that carbonic anhydrase IX (CA IX) expression was not associated with patient age, T stage, grade, lymphovascular invasion, and Ki-67 expression, but was associated with p53 expression.
21547579 The impact of VHL genetic alterations on the expression of several pVHL protein targets in paired normal and tumor tissue, was evaluated.
21519917 Carbonic anhydrase IX overexpression is associated with esophageal cancer.
21454639 CAIX is particularly well suited to maintain the extracellular pH at a value that favors the survival fitness of tumor cells.
21442770 Data suggest that a combination of GLUT1 and CAIX immunocytochemical staining can give a higher diagnostic performance.
21363891 CA9 modulates tumor-associated cell migration and invasion.
21306648 Data show that CA9, GLUT1 and LOX mRNA levels were equally and strongly correlated to hypoxic extent in FaDudd, and the same was observed for CA9 and GLUT1, but not LOX, in SCCVII tumors.
21302028 Data show that colocalization of CAIX, a membrane-bound hypoxic marker and Ki-67, a nuclear proliferation marker were well analyzed with parametric mapping of immunohistochemistry.
21281785 Expression of CA IX in gastric cancer is predominantly regulated by methylation of a single CpG rather than by hypoxia.
21249485 High carbonic anhydrase IX is associated with recurrence in breast cancer.
21223596 Data show that CAIX is associated with advanced tumor stages and lymph node metastases in cervical cancer, potentially representing a new target in this disease.
21209841 analysis of peptide ligands for human carbonic anhydrase IX
21090098 HIF-1alpha and CA IX were over expressed in nasal polyps.
21088149 CAIX expression is more common in clear cell renal carcinoma than other renal tumor types and is associated with grade.
21040473 Data suggest that CA9 may be an important marker for prediction of PYM responsiveness in tongue cancer chemotherapy.
20978319 HIF-1alpha, HIF-2alpha and CAIX were up-regulated in 88.2% (15/17), 100% (17/17) and 88.2% (15/17) of CCRCC tumors respectively and their expression is independent of VHL status.
20964835 the expression level of CAIX in clear cell renal cell carcinoma tumour tissue was determined to infer the presence of hypoxia and/or the likely activation of hypoxia-inducible factor.
20875751 in bladder cancers and related urine sediments, FL-CAIX is the prevalent and is the most accurate clinically relevant variant surrogate of hypoxic stress
20840814 The high expression of CAIX in non-small cell lung cancer tissues is correlated with VEGF level but not with Ki67 level.
20822935 Data indicate that carbonic anhydrase IX (CA9) is a promising molecular marker to differentiate the malignant cystic renal tumors from the benign cysts.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20526721 The expression of HIF-1alpha and GLUT1 proteins was increased after CoCl(2)-induced hypoxia in all breast cancer cell lines tested
20521252 carbonic anhydrase XII has a role in good prognosis in resectable non-small cell lung cancers
20514415 Data indicate that expressions of CA9 and VEGF were associated with tumor grade and possibly with survival.
20461082 High expression of CAIX in tumour tissue is a predictor of worse survival, and a high CAIX plasma level is an independent prognostic biomarker in patients with non small cell lung cancer, in particular in early-stage I+II carcinomas.
20423227 High membranous CA IX is associated with non-small cell lung cancer.
20398423 Suggest that CA IX should be considered a potential prognostic and therapeutic target in medulloblastomas and supratentorial primitive neuroectodermal tumours.
20358226 CAIX is overexpressed in the majority of vulvar carcinomas with relationships to advanced tumor stages and development of lymph node metastases.
20224781 analysis of catalytic domain directed human anti-CAIX antibodies discovered through phage-display technology
20170095 Results indicate that some derivatives showed potent hCA IX and hCA XIV inhibitory effects at nanomolar concentrations as well as low affinity for the ubiquitous hCA II.
20127031 Src induces expression of carbonic anhydrase IX via hypoxia-inducible factor 1.
20038959 Although prostate cancer is a hypoxic tumour it does not express CA IX.
19950233 HBx led to an increase in the expression of CA9 as assessed by RT-PCR and Western blotting in several liver cell lines.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19861127 Findings provide the first evidence for the critical contribution of the IC tail to the proper functioning of CA IX.
19808899 CA-9 expression varied among thyroid cancer subtypes, with high levels detected in the dedifferentiated ATCs. Expression of CA-9 may be associated with a more aggressive disease phenotype in thyroid carcinoma.
19805286 Data show that on the basis of the structural differences between CA IX and the other membrane-associated alpha-CAs, the rational drug design of isozyme-specific CA inhibitors are proposed.
19619339 Carbonic anhydrase 9 may have a role in survival with a lower dose of bevacizumab in patients with previously treated metastatic colorectal cancer
19564335 that expression of CA9 is regulated through both the HIF-1 and unfolded protein response hypoxia response pathways in vitro and in vivo.
19540352 the aim of the study was to investigate the detailed sequence analysis and functional dissection of 1.2 kb human CA9 promoter which lead to further understanding of CA9 transcriptional regulation.
19539328 CA9 single nucleotide polymorphisms are common in patients with metastatic clear cell renal cell carcinoma
19539328 Observational study of gene-disease association. (HuGE Navigator)
19523858 Data show that CAIX expression was present in all groups studied but there was no significant correlation between it and any oxygen parameter studied.
19473055 Increased soluble carbonic anhydrase IX is associated with transitional cell carcinoma of urinary tract.
19469910 The fluid of malignant cystic renal tumours contains a high level of CA9 protein. The measurement of CA9 level in cyst fluid may be used as a molecular diagnosis for differentiation between malignant and benign renal cystic masses.
19458084 CO(2)-producing tumors may express CA9 to facilitate CO(2) excretion, thus raising internal pH and reducing external pH, which promotes tumor proliferation and survival.
19367501 Studies suggest that CAIX expression and activity is associated with metabolic dysfunction in MDA-MB-231 cells.
19347577 CA9, showed that it is capable of selecting an aggressive subgroup of breast cancer patients who are known to have poor prognosis.
19291313 HIF-1alpha and CAIX expression co-localized in many, but not all, of the embryonic and early fetal tissues; CAIX and CAXII expression is closely related to cell origin and secretory activity involving proton transport, respectively.
19204726 Observational study of gene-disease association. (HuGE Navigator)
19165203 CAIX is upregulated in basal-like breast tumours and is associated with resistance to chemotherapy.
19074859 CA9 has chaperone-like functions and CA9 shed from tumors may play a direct role in stimulating an adaptive immune response
19022520 independent prognostic factor in non-small cell lung cancer; high levels of mRNA are predictive of unfavorable outcome
19017360 COX-2/CA-IX interplay promotes the aggressive behaviour of colorectal cancer cells
19008051 CA-9 expression by adenocarcinoma cells may confer long-term survival advantage in surgically treated rectal cancer.
18976937 COX-2 and carbonic anhydrase IX seem to be important predictors of outcome in patients with metastatic renal cell carcinomas
18941400 CA IX expression has potential diagnostic implications including (i) clear cell RCC versus chromophobe RCC and (ii) urothelial carcinoma versus collecting duct carcinoma.
18841153 findings show that CA9 is correlated with poor prognosis and malignant phenotype in patients with oesophageal squamous cell carcinoma, and was upregulated by hypoxia
18728663 Poorer survival of HIF-2 alpha and CA9 stromal-positive CRCs was associated with wild-type TP53, but not with BNIP3 methylation
18703501 Biochemical characterization of CA IX, one of the most active carbonic anhydrase isozymes.
18695901 Low expression of CAIX and high expression of VEGF is associated with metastasis in clear cell renal cell carcinoma.
18676750 CSF1, EGFR, and CA IX have roles in increasing survival in early-stage squamous cell carcinoma of the lung
18482982 Diffusion-reaction modeling indicates that CA9 coordinates pH(i) spatially by facilitating CO(2) diffusion in the unstirred extracellular space of the spheroid
18464292 Low CA-IX expression and absence of VHL mutation being associated with a poor clinicopathological phenotype and diminished survival.
18440050 CA9 demonstrated significant associations with disease recurrence and poor clinical outcome and shows potential as a prognostic factor for oral squamous cell carcinoma.
18336316 Carbonic anhydrase IX plays an important role in acidification of the external cell matrix, and as a potential marker of hypoxic tumor and therapeutic target. [Review]
18336315 Carbonic anhydrase (CA) XII as well as CA IX participate in pH regulation, which is important for survival of hypoxic cancer cells. Both enzymes are therefore promising targetable therapeutic molecules. [Review]
18290322 A role for CA9 as an endogenous marker of tumor hypoxia is currently not supported by available clinical data.
18173856 CA IX was proved to be an independent prognostic indicator in oligodendroglial brain tumors, and it also correlates reversely with cell proliferation
18060036 IL-6 induced Notch-3-dependent upregulation of the carbonic anhydrase IX gene and promoted a hypoxia-resistant/invasive phenotype in MCF-7 cells and MS.
18026188 description of an alternative splicing variant of the CA9 mRNA, which does not contain exons 8-9 & is expressed in tumour cells independently of hypoxia; data indicate that the splicing variant can functionally interfere with the full-length CA IX
17906661 CAIX was inferior to pO2 measurements as a tool for patient stratification. Improved analytical methods to account for intratumoral heterogeneity are needed to provide reliable measurements of molecular markers.
17855694 CA IX expression seems to be very high in most cases of hereditary nonpolyposis colorectal cancer; CA IX could be a potential diagnostic and therapeutic target in HNPCC.
17852557 high levels of the hypoxia regulated proteins HIF1alpha and CA9 in HNC predict resistance to platinum based radio-chemotherapy.
17706406 in bladder cancer, no significant correlation was shown between the overall carbonic anhydrase IX(CA IX) status and the initial response to radiotherapy, 5-year cancer-specific survival or time to local recurrence
17674038 Expression of hypoxia-inducible factor-1alpha (HIF-1alpha) and carbonic anhydrase IX (CA IX) are markers of cellular hypoxia.
17652430 CAIX can bind to some Cl(-)/HCO(3)(-) exchangers to form a bicarbonate transport metabolon.
17536770 MN/CA9 gene expression was detected in 53/59 (89.8%) pleural effusions from cancer patients (15/16 breast cancers, 10/11 lung cancers, 4/4 ovary cancers, 2/3 colon-rectal cancers, 5/6 cancers of unknown site, 7/8 mesothelioma & 10/11 other cancers)
17452775 The role of protein expression of hypoxia-inducible factor (HIF)-1alpha, HIF-2alpha, carbonic anhydrase 9 (CA9) and glucose transporter 1 (GLUT1) in patients with colorectal adenocarcinomas.
17390110 study confirms that the expression level of CA9 gene in conventional renal cell carcinoma is related to metastasis
17367605 evidence CAIX expression in astrocytic glioma is related to HIF-1alpha & VEGF & associated with extent of necrosis, grade, proliferative potential & morphometric characteristics of microvessels; may be used as prognostic indicator in diffuse astrocytoma
17245699 Overexpression of carbonic anhydrase IX is associated with breast carcinomas
17200340 carbonic anhydrase 9 expression is associated with anaplastic phenotypes in meningiomas
16964400 Acidosis increases the CA IX expression via a hypoxia-independent mechanism that operates through modulation of the basic CA9 transcriptional machinery.
16954440 CAIX expression in breast cancer patients shows a negative predictive role of treatment efficacy in estrogen receptor-positive patients.
16944313 Immunohistochemical carbonic anhydrase IX staining in human malignant glioma specimens can result from low oxygen concentrations or constitutive, oncogene-related, overexpression both of which may be prognostically relevant.
16533775 High carbonic anhydrase IX expression is associated with non-small cell lung cancers
16428489 High levels of carbonic anhydrase IX is associated with astrocytoma
16416108 The strong correlation between CA9 expression and metastasis suggests that CA9 expression might be an important indicator for identifying patients who require more aggressive systemic therapy.
16288478 Collectively these findings establish the importance of intracellular ascorbate levels for the regulation of expression of CA IX and NDRG1/Cap43.
16243791 Data indicate expression of Carbonic anhydrase IX does not correlate with the oxygenation status.
16168127 Coexpression of HIF-1alpha and CAIX in the epithelium in phyllodes tumors points to epithelial hypoxia, most probably caused by relatively distant blood vessels.
15935515 HIF-1alpha and CA IX, but not VEGF or MMP-9, may have a role in progression of surgically resected non-small cell lung cancer
15856466 potential value of CA9 as a molecular marker for the assessment of regional lymph node status in vulvar cancer patients
15849821 The interplay between the functional von Hippel-Lindau tumor suppressor and CA IX/CA XII in colorectal tumors seems rather complex and is not evident merely at the expression levels.
15847702 CA IX and GLUT 1 as well as VEGF and IL 6 have roles in response of in head and neck squamous cell carcinoma to radiotherapy +/- chemotherapy
15837325 Isothiocyanato sulfonamide thioureas inhibit this enzyme.
15833446 MAPK cascade is involved in the regulation of CA9 gene expression under both hypoxia and high cell density.
15809767 Expressed in a high percentage of human cancers derived from tissues which are normally CA IX-negative.
15671533 CA9 is expressed in head and neck squamous cell carcinomas, suggesting the presence of a population of tumor cells under intermediate hypoxic conditions which still has proliferative capacity
15585626 Increased carbonic anhydrase IX is associated with non-small cell lung cancer
15556624 Cell hypoxia activates the capacity of tumor-associated CA9 to acidify extracellular pH.
15500003 tumors with higher redox state exhibited an algebraically lower CA IX expression
15240538 CAIX has a role in progression of high-grade soft tissue sarcoma
15199132 upon activation by DNA damage, wt p53 mediates an accelerated degradation of HIF-1alpha protein, resulting in reduced activation of CA9 transcription and, correspondingly, decreased levels of CA9 protein
15184875 HIF-1alpha and Sp1, in combination with CBP/p300, are crucial elements for G250MN expression in ccRCC, and CAIXG250 can be regarded as a unique HIF-1alpha target gene in ccRCC.
15069539 significantly higher rate of strong CA IX expression in non-invasive cancers influences survival data
14654550 No correlation between CA IX expression and tumor pO(2) levels or patient outcome in locally advanced carcinomas of the cervix.
12865916 CA9 is detectable in breast tumor and associated with resistance to both adjuvant chemotherapy and endocrine therapy
12854129 The variations observed in the CA IX levels support the concept that gastric adenomas and carcinomas are distinct entities and do not represent progressive steps of a single pathway.
12615703 Expression of the hypoxia marker carbonic anhydrase IX is critically dependent on SP1 activity.
12576453 This enzyme is an independent predictor for survival in advanced renal clear cell carcinoma.
12560438 mCA IX is a marker of tumor cell hypoxia, and absence of CA IX staining close to microvessels suggests that these vessels are functionally active; pCA IX expression is representative of an aggressive phenotype
12154057 Lowered oxygen tension induces expression of the hypoxia marker MN/carbonic anhydrase IX in the absence of hypoxia-inducible factor 1 alpha stabilization: a role for phosphatidylinositol 3'-kinase.
12137853 The methylation status of the G250 gene correlates with G250 expression in vitro but not in vivo.
11705854 CA9 might be a marker of clinically important hypoxia.
11676494 Human CA IX was very strongly inhibited by three classic sulfonamides and cyanate

AA Sequence

MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPLGEEDLPSEED      1 - 70
SPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSH     71 - 140
WRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGL    141 - 210
EMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLE    211 - 280
EGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVM    281 - 350
LSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF    351 - 420
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA                                   421 - 459
//

Text Mined References (238)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26794023 2016 Intrinsic thermodynamics of inhibitor binding to human carbonic anhydrase IX.
26648580 2016 CA IX is upregulated in CoCl2-induced hypoxia and associated with cell invasive potential and a poor prognosis of breast cancer.
26648507 2016 Characteristics of carbonic anhydrase 9 expressing cells in human intestinal crypt base.
26553365 2016 Carbonic Anhydrase 9 mRNA/microRNA34a Interplay in Hypoxic Human Mammospheres.
26522624 2015 Efficient Expression and Crystallization System of Cancer-Associated Carbonic Anhydrase Isoform IX.
26510737 2016 Influence of hypoxia-dependent factors on the progression of neuroblastoma.
26337752 2015 Hypoxia-induced carbonic anhydrase IX facilitates lactate flux in human breast cancer cells by non-catalytic function.
26259239 2015 Evaluation of carbonic anhydrase IX as a therapeutic target for inhibition of breast cancer invasion and metastasis using a series of in vitro breast cancer models.
26252502 2015 Inhibition of carbonic anhydrase IX (CA9) sensitizes renal cell carcinoma to ionizing radiation.
26249175 2015 Carbonic Anhydrase Activity Monitored In Vivo by Hyperpolarized 13C-Magnetic Resonance Spectroscopy Demonstrates Its Importance for pH Regulation in Tumors.
26138037 2015 Carbonic anhydrase IX as a diagnostic urinary marker for urothelial bladder cancer.
26130414 2015 Carbonic anhydrase IX overexpression regulates the migration and progression in oral squamous cell carcinoma.
26026587 2015 The impact of immunohistochemical staining with ezrin-carbonic anhydrase IX and neuropilin-2 on prognosis in patients with metastatic renal cell cancer receiving tyrosine kinase inhibitors.
25963717 2015 mRNA expression levels of hypoxia-induced and stem cell-associated genes in human glioblastoma.
25890268 2015 ZEB1 transcriptionally regulated carbonic anhydrase 9 mediates the chemoresistance of tongue cancer via maintaining intracellular pH.
25862852 2015 The novel CA IX inhibition antibody chKM4927 shows anti-tumor efficacy in vivo.
25793203 2015 Binding of carbonic anhydrase IX to 45S rDNA genes is prevented by exportin-1 in hypoxic cells.
25755787 2015 CA9 overexpression is an independent favorable prognostic marker in intrahepatic cholangiocarcinoma.
25738958 2015 Expression of hypoxic marker carbonic anhydrase IX predicts poor prognosis in resectable hepatocellular carcinoma.
25603870 2015 [Significance of detection of serum carbonic anhydrase IX in the diagnosis of lung cancer].
25577552 2015 Expression of carbonic anhydrase 9 is a novel prognostic marker in resectable hepatocellular carcinoma.
25434612 2015 Imaging of CAIX-expressing xenografts in vivo using 99mTc-HEHEHE-ZCAIX:1 affibody molecule.
25431204 2015 Expression and diagnostic implications of carbonic anhydrase IX in several tumours with predominantly clear cell morphology.
25426861 2014 Prognostic value of carbonic anhydrase IX immunohistochemical expression in renal cell carcinoma: a meta-analysis of the literature.
25422154 2015 Prognostic relevance of carbonic anhydrase IX expression is distinct in various subtypes of breast cancer and its silencing suppresses self-renewal capacity of breast cancer cells.
25377659 2014 Expression of HIF-1? and CAIX in nasopharyngeal carcinoma and their correlation with patients' prognosis.
25374230 2014 High monocarboxylate transporter 4 protein expression in stromal cells predicts adverse survival in gastric cancer.
25230982 2014 Monoclonal antibody G250 targeting CA ?: Binding specificity, internalization and therapeutic effects in a non-renal cancer model.
25130478 2015 Assessment of carbonic anhydrase IX expression and extracellular pH in B-cell lymphoma cell line models.
25117006 2015 Hypoxia-induced carbonic anhydrase IX as a target for cancer therapy: from biology to clinical use.
25031713 2014 Oncogenic roles of carbonic anhydrase IX in human nasopharyngeal carcinoma.
24926090 2014 Carbonic anhydrase IX (CAIX) does not differentiate between benign and malignant mesothelium.
24893880 2014 Carbonic anhydrase 9 is associated with chemosensitivity and prognosis in breast cancer patients treated with taxane and anthracycline.
24886661 2014 Carnosine inhibits carbonic anhydrase IX-mediated extracellular acidosis and suppresses growth of HeLa tumor xenografts.
24878360 2014 Carbonic anhydrase inhibitors: Synthesis, molecular docking, cytotoxic and inhibition of the human carbonic anhydrase isoforms I, II, IX, XII with novel benzenesulfonamides incorporating pyrrole, pyrrolopyrimidine and fused pyrrolopyrimidine moieties.
24821582 2014 Carbonic anhydrase 9 expression increases with vascular endothelial growth factor-targeted therapy and is predictive of outcome in metastatic clear cell renal cancer.
24745019 2014 The role of Hypoxia-inducible factor-1 ? , glucose transporter-1, (GLUT-1) and carbon anhydrase IX in endometrial cancer patients.
24737069 2014 Stromal expression of carbonic anhydrase IX in esophageal cancer.
24695043 2014 Increased expression of carbonic anhydrase IX in oral submucous fibrosis and oral squamous cell carcinoma.
24518567 2014 Expression pattern of carbonic anhydrase IX in Medullary thyroid carcinoma supports a role for RET-mediated activation of the HIF pathway.
24471939 2014 Expression of carbonic anhydrase IX (CAIX) in malignant mesothelioma. An immunohistochemical and immunocytochemical study.
24436269 2014 Immunohistochemical reevaluation of carbonic anhydrase IX (CA IX) expression in tumors and normal tissues.
24349364 2013 Impacts of CA9 gene polymorphisms on urothelial cell carcinoma susceptibility and clinicopathologic characteristics in Taiwan.
24217923 2014 Carbonic anhydrase IX expression is associated with favorable prognostic factors in small intestinal carcinoma.
24146383 2014 Carbonic anhydrase IX (CAIX) as a mediator of hypoxia-induced stress response in cancer cells.
24146382 2014 Carbonic anhydrase IX as an imaging and therapeutic target for tumors and metastases.
24146381 2014 Carbonic anhydrase IX: regulation and role in cancer.
24111817 2014 Carbonic anhydrase IX is strongly overexpressed in adenocarcinoma in situ of the cervix uteri.
24068505 2014 A novel VHH nanobody against the active site (the CA domain) of tumor-associated, carbonic anhydrase isoform IX and its usefulness for cancer diagnosis.
24008660 2013 The prognostic impact of a combined carbonic anhydrase IX and Ki67 signature in oral squamous cell carcinoma.
23957700 2014 Expression of CA IX in dysplasia adjacent to surgical resection margins of oral squamous cell carcinoma.
23910904 2013 Response of CAIX and CAXII to in vitro re-oxygenation and clinical significance of the combined expression in NSCLC patients.
23869833 2013 [Expression of carbonic anhydrase IX in the breast carcinomas].
23860929 2013 Molecular imaging with a fluorescent antibody targeting carbonic anhydrase IX can successfully detect hypoxic ductal carcinoma in situ of the breast.
23802595 2013 Carbon anhydrase IX specific immune responses in patients with metastatic renal cell carcinoma potentially cured by interleukin-2 based immunotherapy.
23656776 2013 Carbonic anhydrase IX from cancer-associated fibroblasts drives epithelial-mesenchymal transition in prostate carcinoma cells.
23512428 2013 Diagnostic and prognostic significance of CA IX and suPAR in gastric cancer.
23503645 2013 Value of PAX8, PAX2, napsin A, carbonic anhydrase IX, and claudin-4 immunostaining in distinguishing pleural epithelioid mesothelioma from metastatic renal cell carcinoma.
23391777 2013 Carbonic anhydrase type IX expression in lobular endocervical glandular hyperplasia and gastric-type adenocarcinoma of the uterine cervix.
23372804 2013 Peroxisome proliferator activated receptor-?/hypoxia inducible factor-1? interplay sustains carbonic anhydrase IX and apoliprotein E expression in breast cancer stem cells.
23299542 2013 Endocervical glandular neoplasia associated with lobular endocervical glandular hyperplasia is HPV-independent and correlates with carbonic anhydrase-IX expression: a Gynaecological Oncology Group Study.
23291973 2013 Suppression of carbonic anhydrase IX leads to aberrant focal adhesion and decreased invasion of tumor cells.
23263636 2013 Hypoxia-related molecules HIF-1?, CA9, and osteopontin : predictors of survival in patients with high-grade glioma.
23226559 2012 Impacts of CA9 gene polymorphisms and environmental factors on oral-cancer susceptibility and clinicopathologic characteristics in Taiwan.
23226406 2012 In vivo imaging and quantification of carbonic anhydrase IX expression as an endogenous biomarker of tumor hypoxia.
23208505 2013 Targeting carbonic anhydrase IX depletes breast cancer stem cells within the hypoxic niche.
23141780 2013 Carbonic anhydrase IX as a potential biomarker of efficacy in metastatic clear-cell renal cell carcinoma patients receiving sorafenib or placebo: analysis from the treatment approaches in renal cancer global evaluation trial (TARGET).
23098453 2012 Expression of endogenous hypoxia markers in vulvar squamous cell carcinoma.
23074198 2012 Function of carbonic anhydrase IX in glioblastoma multiforme.
22976806 2012 Hypoxia-induced protein CAIX is associated with somatic loss of BRCA1 protein and pathway activity in triple negative breast cancer.
22918393 2012 Prognostic utility of pre-operative circulating osteopontin, carbonic anhydrase IX and CRP in renal cell carcinoma.
22843905 2012 Main effects and interactions of carbonic anhydrase IX, hypoxia-inducible factor-1?, ezrin and glucose transporter-1 in multivariate analysis for disease outcome in rectal cancer.
22699808 2012 Co-expression of VEGF and CA9 in ovarian high-grade serous carcinoma and relationship to survival.
22486898 2012 Expression of CA-IX is associated with advanced stage tumors and poor survival in oral squamous cell carcinoma patients.
22484976 2012 Phosphorylation of signal transducer and activator of transcription 3 (STAT3) correlates with Her-2 status, carbonic anhydrase 9 expression and prognosis in esophageal cancer.
22465027 2012 Role of zinc in catalytic activity of carbonic anhydrase IX.
22436629 2012 Carbonic anhydrase IX up-regulation is associated with adverse clinicopathologic and biologic factors in neuroblastomas.
22430125 2012 Dickkopf-1 (DKK-1) interrupts FAK/PI3K/mTOR pathway by interaction of carbonic anhydrase IX (CA9) in tumorigenesis.
22367930 2012 Detection of carbonic anhydrase IX protein in the diagnosis of malignant pleural effusion by enzyme-linked immunosorbent assay and immunocytochemistry.
22366443 2012 High stromal carbonic anhydrase IX expression is associated with nodal metastasis and decreased survival in patients with surgically-treated oral cavity squamous cell carcinoma.
22289741 2012 Recent developments in targeting carbonic anhydrase IX for cancer therapeutics.
22199327 2011 Carbonic anhydrase IX, hypoxia-inducible factor-1?, ezrin and glucose transporter-1 as predictors of disease outcome in rectal cancer: multivariate Cox survival models following data reduction by principal component analysis of the clinicopathological predictors.
22175902 2011 Expression of carbonic anhydrase IX in genitourinary and adrenal tumours.
22170054 2012 Carbonic anhydrase IX interacts with bicarbonate transporters in lamellipodia and increases cell migration via its catalytic domain.
22147747 2012 Therapeutic mechanism and efficacy of the antibody-drug conjugate BAY 79-4620 targeting human carbonic anhydrase 9.
22133596 2012 The expression of the hypoxia markers CA9 and CXCR4 is correlated with survival in patients with neuroendocrine tumours of the ileum.
22087255 2011 Characterization of non-specific cytotoxic cell receptor protein 1: a new member of the lectin-type subfamily of F-box proteins.
22037869 2011 Phosphorylation of carbonic anhydrase IX controls its ability to mediate extracellular acidification in hypoxic tumors.
21966417 2011 Differential impact of EGFR-targeted therapies on hypoxia responses: implications for treatment sensitivity in triple-negative metastatic breast cancer.
21959110 2011 Hypoxia-inducible factors in OSCC.
21910893 2011 Overexpression of carbonic anhydrase and HIF-1? in Wilms tumours.
21870331 2011 GLUT1 and CAIX expression profiles in breast cancer correlate with adverse prognostic factors and MCT1 overexpression.
21761968 2011 Expression of carbonic anhydrase IX in craniopharyngiomas.
21745383 2011 Prospective evaluation of serum tissue inhibitor of metalloproteinase 1 and carbonic anhydrase IX in correlation to circulating tumor cells in patients with metastatic breast cancer.
21694464 2010 Diagnostic and prognostic tissuemarkers in clear cell and papillary renal cell carcinoma.
21691815 2011 Overexpression of carbonic anhydrase IX (CAIX) is an independent unfavorable prognostic marker in endometrioid ovarian cancer.
21664839 2013 Prognostic value of carbonic anhydrase IX expression in penile squamous cell carcinoma: a pilot study.
21547579 2011 VHL genetic alteration in CCRCC does not determine de-regulation of HIF, CAIX, hnRNP A2/B1 and osteopontin.
21519917 2011 Carbonic anhydrase IX overexpression is associated with diminished prognosis in esophageal cancer and correlates with Her-2 expression.
21454639 2011 Catalysis and pH control by membrane-associated carbonic anhydrase IX in MDA-MB-231 breast cancer cells.
21442770 2011 Diagnostic value of metabolic phenotypes in malignant pleural effusions: expression of GLUT1 and CAIX by immunocytochemistry.
21363891 2011 Carbonic anhydrase IX (CA9) modulates tumor-associated cell migration and invasion.
21306648 2011 In vivo identification and specificity assessment of mRNA markers of hypoxia in human and mouse tumors.
21302028 2011 Parametric mapping of immunohistochemically stained tissue sections; a method to quantify the colocalization of tumor markers.
21281785 2011 Expression of hypoxic marker CA IX is regulated by site-specific DNA methylation and is associated with the histology of gastric cancer.
21249485 2011 Prognostic significance of carbonic anhydrase IX (CA-IX), endoglin (CD105) and 8-hydroxy-2'-deoxyguanosine (8-OHdG) in breast cancer patients.
21223596 2011 Carbonic anhydrase IX in tumor tissue and sera of patients with primary cervical cancer.
21209841 2010 A new peptide ligand for targeting human carbonic anhydrase IX, identified through the phage display technology.
21090098 2010 [HIF-1alpha and CA IX expression in nasal polyps and study on their correlation].
21088149 2010 Carbonic anhydrase IX expression in renal neoplasms: correlation with tumor type and grade.
21040473 2010 Identification of carbonic anhydrase 9 as a contributor to pingyangmycin-induced drug resistance in human tongue cancer cells.
20978319 2010 VHL genetic alteration in CCRCC does not determine de-regulation of HIF, CAIX, hnRNP A2/B1 and osteopontin.
20964835 2010 The VHL-dependent regulation of microRNAs in renal cancer.
20875751 Splicing variants of carbonic anhydrase IX in bladder cancer and urine sediments.
20840814 2010 [Expression of carbonic anhydrase IX in NSCLC and its relationship with VEGF and Ki67 expression].
20822935 CA9 as a molecular marker for differential diagnosis of cystic renal tumors.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20526721 2010 Hypoxia and metabolic phenotypes during breast carcinogenesis: expression of HIF-1alpha, GLUT1, and CAIX.
20521252 2011 Overexpression of carbonic anhydrase XII in tissues from resectable non-small cell lung cancers is a biomarker of good prognosis.
20514415 2010 The expressions of carbonic anhydrase 9 and vascular endothelial growth factor in astrocytic tumors predict a poor prognosis.
20461082 2010 High levels of carbonic anhydrase IX in tumour tissue and plasma are biomarkers of poor prognostic in patients with non-small cell lung cancer.
20423227 2010 Carbonic anhydrase IX expression correlates with FDG uptake by primary non-small cell lung cancer.
20398423 2010 The tumour-associated carbonic anhydrases CA II, CA IX and CA XII in a group of medulloblastomas and supratentorial primitive neuroectodermal tumours: an association of CA IX with poor prognosis.
20358226 2010 Overexpression of carbonic anhydrase IX (CAIX) in vulvar cancer is associated with tumor progression and development of locoregional lymph node metastases.
20224781 2010 Unique biological properties of catalytic domain directed human anti-CAIX antibodies discovered through phage-display technology.
20170095 2010 Identification of 3,4-Dihydroisoquinoline-2(1H)-sulfonamides as potent carbonic anhydrase inhibitors: synthesis, biological evaluation, and enzyme--ligand X-ray studies.
20127031 2010 Src induces expression of carbonic anhydrase IX via hypoxia-inducible factor 1.
20038959 2010 Carbonic anhydrase IX expression in prostate cancer.
19950233 2010 Role of the HBx oncoprotein in carbonic anhydrase 9 induction.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19861127 2009 Intact intracellular tail is critical for proper functioning of the tumor-associated, hypoxia-regulated carbonic anhydrase IX.
19808899 2010 Expression of hypoxia-inducible factor 1 alpha in thyroid carcinomas.
19805286 2009 Crystal structure of the catalytic domain of the tumor-associated human carbonic anhydrase IX.
19619339 2009 Carbonic anhydrase 9 is a predictive marker of survival benefit from lower dose of bevacizumab in patients with previously treated metastatic colorectal cancer.
19564335 2009 Hypoxia-induced expression of carbonic anhydrase 9 is dependent on the unfolded protein response.
19540352 2009 TGF-beta upregulates tumor-associated carbonic anhydrase IX gene expression in Hep3B cells.
19539328 2009 CA9 gene: single nucleotide polymorphism predicts metastatic renal cell carcinoma prognosis.
19523858 Investigation of hypoxia and carbonic anhydrase IX expression in a renal cell carcinoma xenograft model with oxygen tension measurements and ¹²?I-cG250 PET/CT.
19473055 2009 Soluble form of carbonic anhydrase IX (CAIX) in transitional cell carcinoma of urinary tract.
19469910 2009 CA9 level in renal cyst fluid: a possible molecular diagnosis of malignant tumours.
19458084 2009 The role of carbonic anhydrase 9 in regulating extracellular and intracellular ph in three-dimensional tumor cell growths.
19367501 2009 Expression and activity of carbonic anhydrase IX is associated with metabolic dysfunction in MDA-MB-231 breast cancer cells.
19347577 2010 A validated gene expression profile for detecting clinical outcome in breast cancer using artificial neural networks.
19291313 2009 Expression of transmembrane carbonic anhydrases, CAIX and CAXII, in human development.
19206230 2009 Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19186056 2009 A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.
19165203 2009 The key hypoxia regulated gene CAIX is upregulated in basal-like breast tumours and is associated with resistance to chemotherapy.
19074859 2008 Carbonic anhydrase IX has chaperone-like functions and is an immunoadjuvant.
19022520 2009 Alternative splicing variants of carbonic anhydrase IX in human non-small cell lung cancer.
19017360 2009 Cyclooxygenase-2/carbonic anhydrase-IX up-regulation promotes invasive potential and hypoxia survival in colorectal cancer cells.
19008051 2009 Assessment of microvessel density and carbonic anhydrase-9 (CA-9) expression in rectal cancer.
18976937 Molecular biomarkers for advanced renal cell carcinoma: implications for prognosis and therapy.
18941400 2009 Diagnostic implications of transcription factor Pax 2 protein and transmembrane enzyme complex carbonic anhydrase IX immunoreactivity in adult renal epithelial neoplasms.
18841153 2008 Expression of carbonic anhydrase 9, a potential intrinsic marker of hypoxia, is associated with poor prognosis in oesophageal squamous cell carcinoma.
18728663 2008 Poorer outcome in stromal HIF-2 alpha- and CA9-positive colorectal adenocarcinomas is associated with wild-type TP53 but not with BNIP3 promoter hypermethylation or apoptosis.
18703501 2008 Biochemical characterization of CA IX, one of the most active carbonic anhydrase isozymes.
18695901 2008 Prognostic value of the co-expression of carbonic anhydrase IX and vascular endothelial growth factor in patients with clear cell renal cell carcinoma.
18676750 2008 Three-gene expression signature predicts survival in early-stage squamous cell carcinoma of the lung.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18482982 2008 Tumor-associated carbonic anhydrase 9 spatially coordinates intracellular pH in three-dimensional multicellular growths.
18464292 2008 Low CAIX expression and absence of VHL gene mutation are associated with tumor aggressiveness and poor survival of clear cell renal cell carcinoma.
18440050 2008 Expression of carbonic anhydrase IX is associated with postoperative recurrence and poor prognosis in surgically treated oral squamous cell carcinoma.
18336316 2008 Fluorescence- and spin-labeled carbonic anhydrase inhibitors.
18336315 2008 Cancer-associated carbonic anhydrases and their inhibition.
18290322 2008 Endogenous hypoxia markers: case not proven!
18173856 2008 Carbonic anhydrase IX in oligodendroglial brain tumors.
18060036 2007 IL-6 triggers malignant features in mammospheres from human ductal breast carcinoma and normal mammary gland.
18041760 2008 Stabilization of antibody structure upon association to a human carbonic anhydrase IX epitope studied by X-ray crystallography, microcalorimetry, and molecular dynamics simulations.
18026188 2008 Alternative splicing variant of the hypoxia marker carbonic anhydrase IX expressed independently of hypoxia and tumour phenotype.
17906661 2007 Effect of distributional heterogeneity on the analysis of tumor hypoxia based on carbonic anhydrase IX.
17855694 2007 Carbonic anhydrase IX is highly expressed in hereditary nonpolyposis colorectal cancer.
17852557 2008 Hypoxia inducible factor (HIf1alpha and HIF2alpha) and carbonic anhydrase 9 (CA9) expression and response of head-neck cancer to hypofractionated and accelerated radiotherapy.
17706406 2007 Carbonic anhydrase IX expression and outcome after radiotherapy for muscle-invasive bladder cancer.
17705204 2007 Saccharin inhibits carbonic anhydrases: possible explanation for its unpleasant metallic aftertaste.
17674038 2007 Association of progressive structural changes in the bronchial epithelium with subepithelial fibrous remodeling: a potential role for hypoxia.
17652430 2007 Interactions of transmembrane carbonic anhydrase, CAIX, with bicarbonate transporters.
17536770 MN/CA9: a potential gene marker for detection of malignant cells in effusions.
17452775 2007 Stromal expression of hypoxia regulated proteins is an adverse prognostic factor in colorectal carcinomas.
17390110 2007 CA9 gene expression in conventional renal cell carcinoma: a potential marker for prediction of early metastasis after nephrectomy.
17367605 2007 Expression of hypoxia-related tissue factors in astrocytic gliomas. A multivariate survival study with emphasis upon carbonic anhydrase IX.
17314045 2007 Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.
17245699 2007 HIF-1alpha and CA IX staining in invasive breast carcinomas: prognosis and treatment outcome.
17200340 2007 Expression of the hypoxia marker carbonic anhydrase 9 is associated with anaplastic phenotypes in meningiomas.
16964400 2006 Extracellular acidosis elevates carbonic anhydrase IX in human glioblastoma cells via transcriptional modulation that does not depend on hypoxia.
16954440 2006 Role of carbonic anhydrase IX expression in prediction of the efficacy and outcome of primary epirubicin/tamoxifen therapy for breast cancer.
16944313 2007 Distinct patterns of hypoxic expression of carbonic anhydrase IX (CA IX) in human malignant glioma cell lines.
16533775 2006 An evaluation of tumor oxygenation and gene expression in patients with early stage non-small cell lung cancers.
16428489 2006 Expression of carbonic anhydrase IX in astrocytic tumors predicts poor prognosis.
16416108 2006 Tumor-associated carbonic anhydrases are linked to metastases in primary cervical cancer.
16310354 2005 The role of carbonic anhydrase IX overexpression in kidney cancer.
16288478 2006 Ascorbate depletion mediates up-regulation of hypoxia-associated proteins by cell density and nickel.
16243791 2005 Carbonic anhydrase IX expression and tumor oxygenation status do not correlate at the microregional level in locally advanced cancers of the uterine cervix.
16168127 2005 Expression of hypoxia-inducible factor 1 alpha and its downstream targets in fibroepithelial tumors of the breast.
15935515 2005 Expression of HIF-1alpha, CA IX, VEGF, and MMP-9 in surgically resected non-small cell lung cancer.
15856466 2005 Detection of carbonic anhydrase 9-expressing tumor cells in the lymph nodes of vulvar carcinoma patients by RT-PCR.
15849821 2005 Expression of von Hippel-Lindau tumor suppressor and tumor-associated carbonic anhydrases IX and XII in normal and neoplastic colorectal mucosa.
15847702 2005 The prognostic value of the hypoxia markers CA IX and GLUT 1 and the cytokines VEGF and IL 6 in head and neck squamous cell carcinoma treated by radiotherapy +/- chemotherapy.
15837325 2005 Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides incorporating thioureido-sulfanilyl scaffolds.
15833446 2005 MAPK pathway contributes to density- and hypoxia-induced expression of the tumor-associated carbonic anhydrase IX.
15809767 2005 Carbonic anhydrase IX (CA IX) mediates tumor cell interactions with microenvironment.
15671533 2005 Colocalization of carbonic anhydrase 9 expression and cell proliferation in human head and neck squamous cell carcinoma.
15585626 2004 Carbonic anhydrase IX in early-stage non-small cell lung cancer.
15556624 2004 Hypoxia activates the capacity of tumor-associated carbonic anhydrase IX to acidify extracellular pH.
15500003 2004 Redox state and carbonic anhydrase isozyme IX expression in human renal cell carcinoma: biochemical and morphological investigations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15240538 2004 Carbonic anhydrase IX as a marker for poor prognosis in soft tissue sarcoma.
15199132 2004 DNA damage is a prerequisite for p53-mediated proteasomal degradation of HIF-1alpha in hypoxic cells and downregulation of the hypoxia marker carbonic anhydrase IX.
15184875 2004 Strict regulation of CAIX(G250/MN) by HIF-1alpha in clear cell renal cell carcinoma.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15069539 2004 Carbonic anhydrase IX, a marker of hypoxia: correlation with clinical outcome in transitional cell carcinoma of the bladder.
14654550 2003 Carbonic anhydrase IX expression, hypoxia, and prognosis in patients with uterine cervical carcinomas.
14578124 2003 Gene expression for carbonic anhydrase isoenzymes in human nasal mucosa.
14567991 2003 Carbonic anhydrase IX reduces E-cadherin-mediated adhesion of MDCK cells via interaction with beta-catenin.
12966427 2003 Soluble form of carbonic anhydrase IX (CA IX) in the serum and urine of renal carcinoma patients.
12865916 2003 Carbonic anhydrase-9 expression levels and prognosis in human breast cancer: association with treatment outcome.
12854129 2003 Carbonic anhydrase isozymes IX and XII in gastric tumors.
12676895 2003 Expression of cell surface transmembrane carbonic anhydrase genes CA9 and CA12 in the human eye: overexpression of CA12 (CAXII) in glaucoma.
12615703 2003 Expression of the hypoxia marker carbonic anhydrase IX is critically dependent on SP1 activity. Identification of a novel type of hypoxia-responsive enhancer.
12576453 2003 Carbonic anhydrase IX is an independent predictor of survival in advanced renal clear cell carcinoma: implications for prognosis and therapy.
12560438 2003 Carbonic anhydrase IX expression, a novel surrogate marker of tumor hypoxia, is associated with a poor prognosis in non-small-cell lung cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154057 2002 Lowered oxygen tension induces expression of the hypoxia marker MN/carbonic anhydrase IX in the absence of hypoxia-inducible factor 1 alpha stabilization: a role for phosphatidylinositol 3'-kinase.
11680594 2001 Differential expression of cytoplasmic carbonic anhydrases, CA I and II, and membrane-associated isozymes, CA IX and XII, in normal mucosa of large intestine and in colorectal tumors.
11303978 Carbonic anhydrase isozymes in the human pancreas.
11083462 2000 Expression of transmembrane carbonic anhydrase isoenzymes IX and XII in normal human pancreas and pancreatic tumours.
10709109 2000 Molecular cloning and immunogenicity of renal cell carcinoma-associated antigen G250.
9787087 1998 Radiation hybrid mapping of the human MN/CA9 locus to chromosome band 9p12-p13.
9770531 1998 Down-regulation of transmembrane carbonic anhydrases in renal cell carcinoma cell lines by wild-type von Hippel-Lindau transgenes.
9524195 1998 Immunohistochemistry of carbonic anhydrase isozyme IX (MN/CA IX) in human gut reveals polarized expression in the epithelial cells with the highest proliferative capacity.
9024293 1997 Carbonic anhydrase IX, MN/CA IX: analysis of stomach complementary DNA sequence and expression in human and rat alimentary tracts.
8661007 1996 Human MN/CA9 gene, a novel member of the carbonic anhydrase family: structure and exon to protein domain relationships.
8486430 1993 Expression of MaTu-MN protein in human tumor cultures and in clinical specimens.
8084592 1994 Cloning and characterization of MN, a human tumor-associated protein with a domain homologous to carbonic anhydrase and a putative helix-loop-helix DNA binding segment.
1312272 1992 A novel quasi-viral agent, MaTu, is a two-component system.