Property Summary

NCBI Gene PubMed Count 40
PubMed Score 258.53
PubTator Score 68.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Globe disease 67 0.0 2.1
Heart disease 306 0.0 1.4

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.200 4.3e-03
active ulcerative colitis 1.081 5.6e-03
adult high grade glioma -1.100 4.8e-02
atypical teratoid / rhabdoid tumor -1.100 2.5e-03
Breast cancer -1.700 7.9e-05
colon cancer -1.300 2.7e-02
group 3 medulloblastoma -1.700 3.1e-02
lung cancer 2.800 8.1e-06
lung carcinoma 3.100 1.2e-42
malignant mesothelioma 5.100 7.6e-10
medulloblastoma, large-cell -1.400 3.1e-02
ovarian cancer 1.100 1.6e-05
posterior fossa group A ependymoma -1.300 2.8e-04

Gene RIF (10)

AA Sequence

MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRL      1 - 70
SPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMEL     71 - 140
HLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDP    141 - 210
LLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL    211 - 280
SDRVIRAAFQ                                                                281 - 290
//

Text Mined References (41)

PMID Year Title