Property Summary

Ligand Count 103
NCBI Gene PubMed Count 11
PubMed Score 155.43
PubTator Score 32.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -1.400 1.2e-02
osteosarcoma 2.704 9.9e-07
psoriasis 1.400 1.3e-04

Gene RIF (2)

AA Sequence

MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIR      1 - 70
WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWG     71 - 140
SEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALV    141 - 210
EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDN    211 - 280
FRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP                                     281 - 317
//

Text Mined References (15)

PMID Year Title