Property Summary

Ligand Count 139
NCBI Gene PubMed Count 10
PubMed Score 304.13
PubTator Score 101.42

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQ      1 - 70
WRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGG     71 - 140
SEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARA    141 - 210
AMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNN    211 - 280
YRPLQPLMNRKVWASFQATNEGTRS                                                 281 - 305
//

Text Mined References (18)

PMID Year Title