Property Summary

Ligand Count 243
NCBI Gene PubMed Count 49
PubMed Score 1475.68
PubTator Score 420.60

Knowledge Summary


No data available


  Disease (6)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 17 7 0.0 0.0
Disease Target Count
Retinitis Pigmentosa 226


  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -1.400 1.8e-03
astrocytic glioma -1.100 2.6e-02
Astrocytoma, Pilocytic -1.300 3.7e-04
colon cancer -1.400 1.0e-03
ductal carcinoma in situ -1.900 4.8e-05
gastric carcinoma -1.300 1.3e-02
glioblastoma -1.300 2.9e-04
group 3 medulloblastoma 3.300 1.2e-05
interstitial cystitis -1.200 2.0e-03
intraductal papillary-mucinous adenoma (... -1.100 1.5e-03
intraductal papillary-mucinous carcinoma... -1.800 2.7e-02
intraductal papillary-mucinous neoplasm ... -1.100 2.1e-02
invasive ductal carcinoma -1.900 2.2e-04
lung adenocarcinoma -1.200 4.8e-19
lung cancer -1.200 2.4e-02
lung carcinoma -1.300 5.8e-16
medulloblastoma, large-cell -1.100 8.6e-03
non-small cell lung cancer -2.914 1.3e-27
osteosarcoma -2.298 6.7e-07
pancreatic cancer -1.400 4.7e-04
pituitary cancer -1.200 2.5e-02
primitive neuroectodermal tumor -1.100 1.7e-02
psoriasis -1.300 1.6e-17
spina bifida 1.214 4.1e-02
subependymal giant cell astrocytoma -1.520 2.3e-02
ulcerative colitis -2.100 1.2e-04

PDB (10)

Gene RIF (21)

AA Sequence

VIKSGAPGRPLPWALPALLGPMLACLLAGFLR                                          281 - 312

Text Mined References (59)

PMID Year Title