Property Summary

NCBI Gene PubMed Count 168
PubMed Score 3301.45
PubTator Score 3644.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 1.89822691015916E-13
lung adenocarcinoma 2714 2.55754010965043E-11
malignant mesothelioma 3163 3.32578465059351E-8
lung carcinoma 2844 8.27815561662093E-8
Duchenne muscular dystrophy 602 2.64588181140113E-7
lung cancer 4473 1.51033131510838E-6
colon cancer 1475 1.83871146157974E-5
medulloblastoma, large-cell 6234 4.95946853854173E-5
Down syndrome 548 1.01132194149152E-4
hepatocellular carcinoma 550 1.03077808226983E-4
limb girdle muscular dystrophy 2B 74 1.44738121827354E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.64117692834539E-4
pancreatic cancer 2300 5.93608473275182E-4
pancreatic carcinoma 567 5.93608473275185E-4
cystic fibrosis 1670 0.00211116868017304
uncontrolled asthma 67 0.00249713758977724
gastric cancer 436 0.00289730240557494
Breast cancer 3099 0.00457906548459127
active ulcerative colitis 477 0.00461602809333549
tuberculosis 1563 0.00715036709930178
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00854942339730323
pituitary cancer 1972 0.0118666271077402
Barrett's esophagus 185 0.0204780914483485
medulloblastoma 1524 0.0273079923237429
mucosa-associated lymphoid tissue lymphoma 480 0.0298714135539353
Disease Target Count Z-score Confidence
Osteopetrosis 40 5.192 2.6

Expression

  Differential Expression (25)

Synonym

Accession P00918 B2R7G8 Q6FI12 Q96ET9
Symbols CAC
CAII
Car2
CA-II
HEL-76
HEL-S-282

Gene

CA2

PANTHER Protein Class (2)

PDB

12CA   1A42   1AM6   1AVN   1BCD   1BIC   1BN1   1BN3   1BN4   1BNM   1BNN   1BNQ   1BNT   1BNU   1BNV   1BNW   1BV3   1CA2   1CA3   1CAH   1CAI   1CAJ   1CAK   1CAL   1CAM   1CAN   1CAO   1CAY   1CAZ   1CCS   1CCT   1CCU   1CIL   1CIM   1CIN   1CNB   1CNC   1CNG   1CNH   1CNI   1CNJ   1CNK   1CNW   1CNX   1CNY   1CRA   1CVA   1CVB   1CVC   1CVD   1CVE   1CVF   1CVH   1DCA   1DCB   1EOU   1F2W   1FQL   1FQM   1FQN   1FQR   1FR4   1FR7   1FSN   1FSQ   1FSR   1G0E   1G0F   1G1D   1G3Z   1G45   1G46   1G48   1G4J   1G4O   1G52   1G53   1G54   1H4N   1H9N   1H9Q   1HCA   1HEA   1HEB   1HEC   1HED   1HVA   1I8Z   1I90   1I91   1I9L   1I9M   1I9N   1I9O   1I9P   1I9Q   1IF4   1IF5   1IF6   1IF7   1IF8   1IF9   1KWQ   1KWR   1LG5   1LG6   1LGD   1LUG   1LZV   1MOO   1MUA   1OKL   1OKM   1OKN   1OQ5   1RAY   1RAZ   1RZA   1RZB   1RZC   1RZD   1RZE   1T9N   1TB0   1TBT   1TE3   1TEQ   1TEU   1TG3   1TG9   1TH9   1THK   1TTM   1UGA   1UGB   1UGC   1UGD   1UGE   1UGF   1UGG   1XEG   1XEV   1XPZ   1XQ0   1YDA   1YDB   1YDC   1YDD   1YO0   1YO1   1YO2   1Z9Y   1ZE8   1ZFK   1ZFQ   1ZGE   1ZGF   1ZH9   1ZSA   1ZSB   1ZSC   2ABE   2AW1   2AX2   2CA2   2CBA   2CBB   2CBC   2CBD   2CBE   2EU2   2EU3   2EZ7   2F14   2FMG   2FMZ   2FNK   2FNM   2FNN   2FOQ   2FOS   2FOU   2FOV   2GD8   2GEH   2H15   2H4N   2HD6   2HKK   2HL4   2HNC   2HOC   2ILI   2NNG   2NNO   2NNS   2NNV   2NWO   2NWP   2NWY   2NWZ   2NXR   2NXS   2NXT   2O4Z   2OSF   2OSM   2POU   2POV   2POW   2Q1B   2Q1Q   2Q38   2QO8   2QOA   2QP6   2VVA   2VVB   2WD2   2WD3   2WEG   2WEH   2WEJ   2WEO   2X7S   2X7T   2X7U   3B4F   3BET   3BL0   3BL1   3C7P   3CA2   3CAJ   3CYU   3D8W   3D92   3D93   3D9Z   3DAZ   3DBU   3DC3   3DC9   3DCC   3DCS   3DCW   3DD0   3DD8   3DV7   3DVB   3DVC   3DVD   3EFI   3EFT   3F4X   3F8E   3FFP   3GZ0   3HFP   3HKN   3HKQ   3HKT   3HKU   3HLJ   3HS4   3IBI   3IBL   3IBN   3IBU   3IEO   3IGP   3K2F   3K34   3K7K   3KIG   3KKX   3KNE   3KOI   3KOK   3KON   3KS3   3KWA   3L14   3M04   3M14   3M1J   3M1K   3M1Q   3M1W   3M2N   3M2X   3M2Y   3M2Z   3M3X   3M40   3M5E   3M5S   3M5T   3M67   3M96   3M98   3MHC   3MHI   3MHL   3MHM   3MHO   3ML2   3MMF   3MNA   3MNH   3MNI   3MNJ   3MNK   3MNU   3MWO   3MYQ   3MZC   3N0N   3N2P   3N3J   3N4B   3NB5   3NI5   3NJ9   3OIK   3OIL   3OIM   3OKU   3OKV   3OY0   3OYQ   3OYS   3P3H   3P3J   3P44   3P4V   3P55   3P58   3P5A   3P5L   3PJJ   3PO6   3PYK   3QYK   3R16   3R17   3RG3   3RG4   3RGE   3RJ7   3RLD   3RYJ   3RYV   3RYX   3RYY   3RYZ   3RZ0   3RZ1   3RZ5   3RZ7   3RZ8   3S71   3S72   3S73   3S74   3S75   3S76   3S77   3S78   3S8X   3S9T   3SAP   3SAX   3SBH   3SBI   3T5U   3T5Z   3T82   3T83   3T84   3T85   3TMJ   3TVN   3TVO   3U3A   3U45   3U47   3U7C   3V2J   3V2M   3V3F   3V3G   3V3H   3V3I   3V3J   3V5G   3V7X   3VBD   3ZP9   4BCW   4BF1   4BF6   4CA2   4CAC   4CQ0   4DZ7   4DZ9   4E3D   4E3F   4E3G   4E3H   4E49   4E4A   4E5Q   4FIK   4FL7   4FPT   4FRC   4FU5   4FVN   4FVO   4G0C   4GL1   4HBA   4HEW   4HEY   4HEZ   4HF3   4HT0   4IDR   4ILX   4ITO   4ITP   4IWZ   4JS6   4JSA   4JSS   4JSW   4JSZ   4K0S   4K0T   4K0Z   4K13   4K1Q   4KAP   4KNI   4KNJ   4KUV   4KUW   4KUY   4KV0   4L5U   4L5V   4L5W   4LHI   4LP6   4M2R   4M2U   4M2V   4M2W   4MDG   4MDL   4MDM   4MLT   4MLX   4MO8   4MTY   4N0X   4N16   4PQ7   4PXX   4PYX   4PYY   4PZH   4Q06   4Q07   4Q08   4Q09   4Q49   4Q6D   4Q6E   4Q78   4Q7P   4Q7S   4Q7V   4Q7W   4Q81   4Q83   4Q87   4Q8X   4Q8Y   4Q8Z   4Q90   4Q99   4Q9Y   4QEF   4QIY   4QJM   4QK1   4QK2   4QK3   4QSA   4QSB   4QSI   4QTL   4QY3   4R59   4R5A   4R5B   4RFC   4RFD   4RH2   4RIU   4RIV   4RN4   4RUX   4RUY   4RUZ   4WL4   4WW6   4XE1   4Y0J   4YGJ   4YGK   4YGL   4YGN   4YVY   4YWP   4YX4   4YXI   4YXO   4YXU   4YYT   4Z0Q   4Z1E   4Z1J   4Z1K   4Z1N   4ZAO   4ZWI   4ZWX   4ZWY   4ZWZ   4ZX0   4ZX1   5A6H   5AMD   5AMG   5AML   5BNL   5BRU   5BRV   5BRW   5BYI   5C8I   5CA2   5CAC   5CLU   5DSI   5DSJ   5DSK   5DSL   5DSM   5DSN   5DSO   5DSP   5DSQ   5DSR   5E28   5E2K   5E2R   5E2S   5EH5   5EH7   5EH8   5EHV   5EHW   5EKH   5EKJ   5EKM   5FDC   5FDI   5FLO   5FLP   5FLQ   5FLR   5FLS   5FLT   5FNG   5FNH   5FNI   5FNJ   5FNK   5FNM   5G01   5G03   5G0B   5G0C   5J8Z   6CA2   7CA2   8CA2   9CA2  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (96)

PMID Text
26698855 Changes in membrane composition may affect the erythrocyte membranes' capacity to increase in vitro hCA II activity
26093313 binding of dorzolamide to bovine and human carbonic anhydrase II
26041446 Suggest an association between CAII and NHE3 that alters the transporter's activity in kidney cell line.
26010488 Using paramagnetic NMR techniques and X-ray absorption spectroscopy we identified an N-terminal Cu(2+) binding site in carbonic anhydrase II.
25849760 carbonic anhydrase catalytic cycle for natural and promiscuous substrates
25720518 identified 2 novel mutations in 2 Chinese families with CAII deficiency syndrome; a nonsense mutation in exon 4 in both families; a splice mutation at the splice donor site of intron 3 in 1 family; the splice-site mutation causes exon 3 skipping in patient's mRNA resulting in an in-frame deletion and a novel premature stop codon
25609088 CAII increases water conductance through AQP1 by a physical interaction between the two proteins.
25400751 The down-regulation of CA II expression was observed in gastric cancer and may serve as an independent prognostic factor for the overall survival of gastric cancer patients.
25286933 Binding of cyanate to CA II is directly to the zinc, displacing the zinc-bound solvent molecule, and not in a site that overlaps with the CO2 substrate-binding site.
25165709 Structure-activity relationships study showed that indolylchalcone derivatives have higher inhibitory activities than pyrido[2,3-d]pyrimidine derivatives on hCA I and hCA II.
More...

AA Sequence

MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEF      1 - 70
DDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGL     71 - 140
AVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIV    141 - 210
LKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK                        211 - 260
//

Text Mined References (255)

PMID Year Title
26698855 2016 The effect of erythrocyte membranes from diabetic and hypercholesterolemic individuals on human carbonic anhydrase II activity.
26093313 2015 Spectroscopic and molecular modeling studies on binding of dorzolamide to bovine and human carbonic anhydrase II.
26041446 2015 Carbonic anhydrase II binds to and increases the activity of the epithelial sodium-proton exchanger, NHE3.
26010488 2015 Characterization of the Copper(II) Binding Sites in Human Carbonic Anhydrase II.
25849760 2015 Theoretical investigation on the restoring step of the carbonic anhydrase catalytic cycle for natural and promiscuous substrates.
25720518 2015 Two novel CAII mutations causing carbonic anhydrase II deficiency syndrome in two unrelated Chinese families.
25609088 2015 Increased water flux induced by an aquaporin-1/carbonic anhydrase II interaction.
25400751 2014 Low CA II expression is associated with tumor aggressiveness and poor prognosis in gastric cancer patients.
25286933 2014 Human carbonic anhydrase II-cyanate inhibitor complex: putting the debate to rest.
25165709 2014 Synthesis and in vitro inhibition effect of new pyrido[2,3-d]pyrimidine derivatives on erythrocyte carbonic anhydrase I and II.
More...