Property Summary

NCBI Gene PubMed Count 15
PubMed Score 73.38
PubTator Score 38.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.100 4.9e-03
atypical teratoid / rhabdoid tumor 4.200 2.7e-07
glioblastoma 1.600 2.1e-03
sonic hedgehog group medulloblastoma 1.800 6.0e-03
medulloblastoma, large-cell 1.500 8.3e-05
primitive neuroectodermal tumor 1.100 4.7e-02
acute quadriplegic myopathy -1.196 2.3e-07
ovarian cancer 1.400 2.6e-11

Gene RIF (4)

PMID Text
24374484 Data indicate that carbonic anhydrase isoform XIV (hCA XIV) shows high sequence identity with the other membrane-associated carbonic anhydrases (hCAs).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20170095 Results indicate that some derivatives showed potent hCA IX and hCA XIV inhibitory effects at nanomolar concentrations as well as low affinity for the ubiquitous hCA II.
17881426 No mutation was found in the coding regions and intron-exon boundaries of the genes for CA II, CA IV, CA XIV, kNCB1, NHE3, NHE8, NHRF1, NHRF2 and SLC26A6 amplified from genomic DNA of family members with pRTA.

AA Sequence

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD      1 - 70
QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD     71 - 140
SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF    141 - 210
RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ    211 - 280
AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA                 281 - 337
//

Text Mined References (25)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24374484 2014 The structural comparison between membrane-associated human carbonic anhydrases provides insights into drug design of selective inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20170095 2010 Identification of 3,4-Dihydroisoquinoline-2(1H)-sulfonamides as potent carbonic anhydrase inhibitors: synthesis, biological evaluation, and enzyme--ligand X-ray studies.
19206230 2009 Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.
19186056 2009 A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.
18618712 2009 Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
17881426 2008 Familial pure proximal renal tubular acidosis--a clinical and genetic study.
17705204 2007 Saccharin inhibits carbonic anhydrases: possible explanation for its unpleasant metallic aftertaste.
17314045 2007 Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.
17127057 2007 Carbonic anhydrase activators: L-Adrenaline plugs the active site entrance of isozyme II, activating better isoforms I, IV, VA, VII, and XIV.
16807956 2006 Carbonic anhydrase activators. Activation of isozymes I, II, IV, VA, VII, and XIV with l- and d-histidine and crystallographic analysis of their adducts with isoform II: engineering proton-transfer processes within the active site of an enzyme.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16686544 2006 Carbonic anhydrase activators. Activation of isoforms I, II, IV, VA, VII, and XIV with L- and D-phenylalanine and crystallographic analysis of their adducts with isozyme II: stereospecific recognition within the active site of an enzyme and its consequences for the drug design.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14578124 2003 Gene expression for carbonic anhydrase isoenzymes in human nasal mucosa.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12611920 2003 Human skeletal muscle and erythrocyte proteins involved in acid-base homeostasis: adaptations to chronic hypoxia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12028451 2002 Carbonic anhydrase XIV: luminal expression suggests key role in renal acidification.
11172051 2001 Expression of membrane-associated carbonic anhydrase XIV on neurons and axons in mouse and human brain.
10512682 1999 Human carbonic anhydrase XIV (CA14): cDNA cloning, mRNA expression, and mapping to chromosome 1.