Property Summary

Ligand Count 140
NCBI Gene PubMed Count 9
PubMed Score 131.81
PubTator Score 37.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.201 8.3e-03
active ulcerative colitis 1.166 9.4e-03
Atopic dermatitis -1.100 2.3e-05
atypical teratoid / rhabdoid tumor -1.300 3.0e-05
Breast cancer -1.800 7.5e-07
cystic fibrosis 1.943 2.5e-05
intraductal papillary-mucinous neoplasm ... 2.800 2.6e-02
medulloblastoma -1.100 4.8e-03
medulloblastoma, large-cell -1.700 2.8e-05
ovarian cancer -2.000 4.6e-05
pancreatic cancer 1.400 1.4e-04
psoriasis -1.100 7.6e-65
tuberculosis -1.300 1.4e-04
urothelial carcinoma -1.700 2.2e-03

Synonym

Accession Q8N1Q1
Symbols CAXIII

Gene

PDB

3CZV   3D0N   3DA2   4HU1   4KNM   4KNN   4QIZ   4QJP   4QJX   4QSJ   5E2N   5LLA   5LLN  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD      1 - 70
FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD     71 - 140
GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW    141 - 210
IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH                      211 - 262
//

Text Mined References (10)

PMID Year Title