Property Summary

Ligand Count 140
NCBI Gene PubMed Count 9
PubMed Score 131.81
PubTator Score 37.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.201 8.3e-03
active ulcerative colitis 1.166 9.4e-03
Atopic dermatitis -1.100 2.3e-05
atypical teratoid / rhabdoid tumor -1.300 3.0e-05
Breast cancer -1.800 7.5e-07
cystic fibrosis 1.943 2.5e-05
intraductal papillary-mucinous neoplasm ... 2.800 2.6e-02
medulloblastoma -1.100 4.8e-03
medulloblastoma, large-cell -1.700 2.8e-05
ovarian cancer -2.000 4.6e-05
pancreatic cancer 1.400 1.4e-04
psoriasis -1.100 7.6e-65
tuberculosis -1.300 1.4e-04
urothelial carcinoma -1.700 2.2e-03

PDB (13)

Gene RIF (3)

AA Sequence

MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD      1 - 70
FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD     71 - 140
GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW    141 - 210
IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH                      211 - 262
//

Text Mined References (10)

PMID Year Title