Property Summary

NCBI Gene PubMed Count 46
PubMed Score 173.23
PubTator Score 118.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hyperchlorhidrosis, Isolated 1 0.0 0.0
Lung Neoplasms 217 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2388 3.833 1.9

Expression

  Differential Expression (29)

Disease log2 FC p
active ulcerative colitis -1.040 2.9e-02
adrenocortical carcinoma 1.010 3.2e-02
adult high grade glioma 1.400 1.8e-02
atypical teratoid / rhabdoid tumor 3.400 8.4e-06
Breast cancer 4.400 2.5e-02
breast carcinoma 1.900 2.6e-03
chronic rhinosinusitis 1.582 1.5e-02
colon cancer -1.900 1.0e-02
cutaneous lupus erythematosus -1.300 2.3e-02
cystic fibrosis 1.861 2.0e-06
fibroadenoma 2.100 1.3e-02
glioblastoma 2.000 2.2e-03
interstitial cystitis -1.800 4.1e-03
intraductal papillary-mucinous adenoma (... -3.100 3.1e-03
lung cancer -1.300 4.5e-03
lung carcinoma -1.300 6.8e-09
malignant mesothelioma -7.700 7.8e-10
medulloblastoma, large-cell 1.200 3.8e-03
nephrosclerosis -1.486 2.1e-02
non-small cell lung cancer 3.224 1.4e-15
oligodendroglioma 1.500 6.2e-03
osteosarcoma 2.433 1.8e-02
ovarian cancer -1.900 1.5e-03
pancreatic cancer -2.000 4.5e-03
posterior fossa group A ependymoma 1.500 1.4e-03
primary pancreatic ductal adenocarcinoma -2.286 1.0e-02
psoriasis 1.100 1.2e-03
sonic hedgehog group medulloblastoma -1.400 1.8e-02
subependymal giant cell astrocytoma 2.521 1.4e-02

Gene RIF (30)

AA Sequence

MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDAS      1 - 70
LTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHF     71 - 140
AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEEL    141 - 210
LPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKF    211 - 280
DERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMET    281 - 350
EAHA                                                                      351 - 354
//

Text Mined References (52)

PMID Year Title