Property Summary

NCBI Gene PubMed Count 42
PubMed Score 163.52
PubTator Score 118.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Isolated hyperchlorhidrosis 1
Disease Target Count P-value
non-small cell lung cancer 2798 1.43413777148717E-15
malignant mesothelioma 3163 7.79898857793161E-10
lung carcinoma 2844 6.78727012867481E-9
ulcerative colitis 2087 2.26480669280814E-6
atypical teratoid / rhabdoid tumor 4369 8.44891934046272E-6
glioblastoma 5572 1.20737867244724E-4
pediatric high grade glioma 2712 1.33522940883294E-4
psoriasis 6685 2.09134982687068E-4
ovarian cancer 8492 5.72436155932743E-4
osteosarcoma 7933 8.02778557580442E-4
posterior fossa group A ependymoma 1511 0.00141008660533854
interstitial cystitis 2299 0.00189154964084862
breast carcinoma 1614 0.00257884293004914
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00313344935429872
medulloblastoma, large-cell 6234 0.00384096709646653
lung cancer 4473 0.00445532483045257
pancreatic cancer 2300 0.00446996238410533
oligodendroglioma 2849 0.00615842540628773
cystic fibrosis and chronic rhinosinusitis 213 0.00623225692813093
primary pancreatic ductal adenocarcinoma 1271 0.0100654008393366
colon cancer 1475 0.0107410714266208
fibroadenoma 557 0.0127706291127128
subependymal giant cell astrocytoma 2287 0.0142853691655955
chronic rhinosinusitis 512 0.014613580782223
sonic hedgehog group medulloblastoma 1482 0.0175762607308794
nephrosclerosis 329 0.0208428127718727
cutaneous lupus erythematosus 1056 0.0226450283148313
Breast cancer 3099 0.0248609387717636
adrenocortical carcinoma 1427 0.0315835306080201
Disease Target Count Z-score Confidence
Cancer 2346 3.767 1.9
Disease Target Count
Hyperchlorhidrosis, isolated 1

Expression

Synonym

Accession O43570 B2RE24 Q53YE5 Q9BWG2
Symbols CAXII
CA-XII
T18816
HsT18816

Gene

PANTHER Protein Class (2)

PDB

1JCZ   1JD0   4HT2   4KP5   4KP8   4Q0L   4QJ0   4QJO   4QJW   4WW8  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (26)

PMID Text
26486891 mutation CA12(E143K) causes mouth dryness disease due to aberrant CA12 glycosylation.
25686827 Suggest CAXII as a new secondary marker of the multidrug resistance phenotype that influences Pgp activity directly.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of carbonic anhydrase XII (CA12) in primary human brain microvascular endothelial cells
23910904 A critical role for re-oxygenation on CAIX and CAXII levels that may select for an aggressive lung cancer phenotype.
23383108 Microarray analysis indicates HIV-1 Tat-induced upregulation of carbonic anhydrase XII (CA12) in primary human brain microvascular endothelial cells
23348702 an upregulation of CAXII in human T-cell acute lymphoblastic leukemia samples supporting the case that CAXII may represent a new therapeutic target for T-ALL/LL.
22944692 Microarray analysis indicates HIV-1 Tat-induced upregulation of carbonic anhydrase XII (CA12) in primary human brain microvascular endothelial cells
22439015 Serum CAXII levels were significantly higher in lung cancer patients than in healthy controls, providing evidence that CAXII may be a novel sero-diagnostic marker for lung cancer.
22172588 The expression of CA XII in oral squamous cell carcinoma (OSCC) samples can predict the progression of OSCC and survival of OSCC patients.
21278619 The development of acidosis with topiramate and zonisamide is not determined by drug dose or by treatment duration, but may be influenced by polymorphisms in the gene for CA type XII.
More...

AA Sequence

MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDAS      1 - 70
LTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHF     71 - 140
AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEEL    141 - 210
LPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKF    211 - 280
DERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMET    281 - 350
EAHA                                                                      351 - 354
//

Text Mined References (48)

PMID Year Title
26486891 2015 Essential role of carbonic anhydrase XII in secretory gland fluid and HCO3 (-) secretion revealed by disease causing human mutation.
25686827 2015 Carbonic anhydrase XII is a new therapeutic target to overcome chemoresistance in cancer cells.
24878360 2014 Carbonic anhydrase inhibitors: Synthesis, molecular docking, cytotoxic and inhibition of the human carbonic anhydrase isoforms I, II, IX, XII with novel benzenesulfonamides incorporating pyrrole, pyrrolopyrimidine and fused pyrrolopyrimidine moieties.
23910904 2013 Response of CAIX and CAXII to in vitro re-oxygenation and clinical significance of the combined expression in NSCLC patients.
23348702 2013 Pharmacological inhibition of carbonic anhydrase XII interferes with cell proliferation and induces cell apoptosis in T-cell lymphomas.
22439015 2012 CAXII Is a sero-diagnostic marker for lung cancer.
22172588 2012 Tumor-associated carbonic anhydrase XII is linked to the growth of primary oral squamous cell carcinoma and its poor prognosis.
21278619 2011 Metabolic acidosis with topiramate and zonisamide: an assessment of its severity and predictors.
21184099 2011 Autosomal recessive hyponatremia due to isolated salt wasting in sweat associated with a mutation in the active site of Carbonic Anhydrase 12.
21040567 2010 Carbonic anhydrase XII expression is associated with histologic grade of cervical cancer and superior radiotherapy outcome.
More...