Property Summary

Ligand Count 2,656
NCBI Gene PubMed Count 73
PubMed Score 2053.50
PubTator Score 4036.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis -2.361 4.1e-02
acute myeloid leukemia -2.200 2.9e-02
colon cancer -2.800 2.1e-03
group 3 medulloblastoma -1.300 3.2e-03
lung cancer -1.500 5.1e-03
mucosa-associated lymphoid tissue lympho... 2.692 1.3e-02
osteosarcoma -5.929 7.7e-05
sarcoidosis 1.300 2.8e-02
tuberculosis 1.900 1.9e-02

PDB (24)

Gene RIF (27)

AA Sequence

MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN      1 - 70
FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD     71 - 140
GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW    141 - 210
IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF                       211 - 261
//

Text Mined References (90)

PMID Year Title