Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis and treatment for 6 months 399 5.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.100 5.0e-03

Gene RIF (1)

AA Sequence

MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIRFLLYFSCSLFTAALW      1 - 70
GALAALFCLQYLGVRVLLRFQRKLSVLLLLLGRRRVDFRLVNELLVYGIHVTMLLVGGLGWCFMVFVDM      71 - 139
//

Text Mined References (6)

PMID Year Title