Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

PMID Text
18976975 Knockdown of chromosome 9 open reading frame 66 (C9orf66) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MRHSVARPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEDLAGPSAGAAARPAAP      1 - 70
PPQPREPGAPGLRRAPPRTRMDSSGLGPCSEAPLHTSAGLSGRNLRAAGGVLPVDLERERAALCARQSGH     71 - 140
GPPAVRWLLGSRGAESGGLARRRVAAEHAQPSANLVCRSALETSAFPPSKPKSPRGRVRARSSDGRLRHP    141 - 210
AWRAGSGGRGGRGPSAELASRYWGRRRALPGAADLRPKGARADDRRPLRAGRKLHLPEAARLPGNVGKSG    211 - 280
EPHKAGEVGNHPRDS                                                           281 - 295
//

Text Mined References (3)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.