Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.175 1.5e-08
ovarian cancer 1.100 1.4e-10
pituitary cancer 1.100 6.5e-03

Gene RIF (1)

AA Sequence

MRHSVARPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEDLAGPSAGAAARPAAP      1 - 70
PPQPREPGAPGLRRAPPRTRMDSSGLGPCSEAPLHTSAGLSGRNLRAAGGVLPVDLERERAALCARQSGH     71 - 140
GPPAVRWLLGSRGAESGGLARRRVAAEHAQPSANLVCRSALETSAFPPSKPKSPRGRVRARSSDGRLRHP    141 - 210
AWRAGSGGRGGRGPSAELASRYWGRRRALPGAADLRPKGARADDRRPLRAGRKLHLPEAARLPGNVGKSG    211 - 280
EPHKAGEVGNHPRDS                                                           281 - 295
//

Text Mined References (3)

PMID Year Title