Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.26
PubTator Score 1.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.300 9.3e-03
astrocytic glioma 1.600 7.8e-03
Astrocytoma, Pilocytic 1.200 1.5e-04
diabetes mellitus -1.100 1.5e-03
ependymoma 1.800 3.2e-03
gastric cancer 1.600 8.1e-03
glioblastoma 1.400 4.6e-05
group 3 medulloblastoma 1.400 3.7e-02
hepatocellular carcinoma 2.200 1.5e-05
intraductal papillary-mucinous adenoma (... 1.200 7.3e-03
intraductal papillary-mucinous carcinoma... 1.300 6.4e-03
intraductal papillary-mucinous neoplasm ... 1.900 9.5e-03
oligodendroglioma 1.800 2.3e-03
osteosarcoma 1.585 5.9e-06
ovarian cancer -1.200 1.8e-03
pancreatic cancer 1.800 7.1e-03
pancreatic carcinoma 1.800 7.1e-03
pancreatic ductal adenocarcinoma liver m... 1.860 7.4e-04
pediatric high grade glioma 1.200 1.1e-02
Pick disease 1.100 7.2e-08
tuberculosis and treatment for 6 months -1.100 1.6e-03

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MDGLLNPRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAADEAAVNWVFV      1 - 70
TDTLNFSFWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDV     71 - 140
SMPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFEGKRVSFYKRAQ    141 - 210
ILVADTWSVLEGKGDGCFKDISSITMFADYRLPQVLAHLGALKYSDDLLKKLLKGEMLSYGDRQEVEIRG    211 - 280
CSLWCVELIRDCLLELIEQKGEKPNGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIYY             281 - 341
//

Text Mined References (10)

PMID Year Title