Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 2.8e-03


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.307 2.8e-03


Accession Q8TAL5


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

KISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE                                 421 - 461

Text Mined References (6)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.