Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.11
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis -1.064 8.0e-03
adrenocortical carcinoma 1.028 2.2e-03
astrocytic glioma -1.500 1.6e-02
Breast cancer 1.500 1.6e-06
group 3 medulloblastoma 1.200 4.4e-03
malignant mesothelioma 1.500 2.0e-07
medulloblastoma, large-cell -1.200 2.1e-03
oligodendroglioma -1.200 3.7e-02
osteosarcoma -1.630 2.3e-03

 Compartment GO Term (3)

AA Sequence

MAKRRAAEPVTFHVPWKRLLLCDFAEQPPPPPLWIRPPGVAHAGQLLGVPEQHRKRKIDAGTMAEPSASP      1 - 70
SKRRDSGDNSAPSGQEREDHGLETGDPPLPPPPVLPGPGEELPGARLPGGGGDDGAGRAGPPRGDWGVAS     71 - 140
RQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDMES                    141 - 194
//

Text Mined References (13)

PMID Year Title