Property Summary

NCBI Gene PubMed Count 13
PubMed Score 60.95
PubTator Score 85.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy -1.152 5.2e-05
adrenocortical carcinoma -1.049 3.0e-04
atypical teratoid / rhabdoid tumor 1.400 1.8e-03
Breast cancer -1.100 2.7e-05
group 4 medulloblastoma -1.100 2.3e-02
ovarian cancer -1.800 1.4e-05
pituitary cancer -1.300 4.6e-05
spina bifida -1.126 3.7e-02
ulcerative colitis 1.100 3.7e-05

Gene RIF (3)

AA Sequence

MDIQLDPARDDLPLMANTSHILVKHYVLDLDVDFESQVIEGTIVLFLEDGNRFKKQNSSIEEACQSESNK      1 - 70
ACKFGMPEPCHIPVTNARTFSSEMEYNDFAICSKGEKDTSDKDGNHDNQEHASGISSSKYCCDTGNHGSE     71 - 140
DFLLVLDCCDLSVLKVEEVDVAAVPGLEKFTRSPELTVVSEEFRNQIVRELVTLPANRWREQLDYYARCS    141 - 210
QAPGCGELLFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRA    211 - 280
LFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPTQLWEECSSWYYYVTMPMPASTFTIAVGCWTEMK    281 - 350
METWSSNDLATERPFSPSEANFRHVGVCSHMEYPCRFQNASATTQEIIPHRVFAPVCLTGACQETLLRLI    351 - 420
PPCLSAAHSVLGAHPFSRLDVLIVPANFPSLGMASPHIMFLSQSILTGGNHLCGTRLCHEIAHAWFGLAI    421 - 490
GARDWTEEWLSEGFATHLEDVFWATAQQLAPYEAREQQELRACLRWRRLQDEMQCSPEEMQVLRPSKDKT    491 - 560
GHTSDSGASVIKHGLNPEKIFMQVHYLKGYFLLRFLAKRLGDETYFSFLRKFVHTFHGQLILSQDFLQML    561 - 630
LENIPEEKRLELSVENIYQDWLESSGIPKPLQRERRAGAECGLARQVRAEVTKWIGVNRRPRKRKRREKE    631 - 700
EVFEKLLPDQLVLLLEHLLEQKTLSPRTLQSLQRTYHLQDQDAEVRHRWCELIVKHKFTKAYKSVERFLQ    701 - 770
EDQAMGVYLYGELMVSEDARQQQLARRCFERTKEQMDRSSAQVVAEMLF                         771 - 819
//

Text Mined References (13)

PMID Year Title