Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.99
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.700 5.1e-05
astrocytic glioma -2.500 6.2e-03
Astrocytoma, Pilocytic -2.700 5.3e-11
atypical teratoid / rhabdoid tumor -2.200 3.2e-06
Endometriosis -1.866 2.2e-02
ependymoma 3.100 8.9e-06
glioblastoma -1.700 5.7e-05
group 3 medulloblastoma -1.900 1.8e-04
lung adenocarcinoma -2.300 4.5e-05
medulloblastoma, large-cell -2.600 5.0e-05
nasopharyngeal carcinoma -3.800 5.8e-08
non-small cell lung cancer -1.462 5.6e-04
oligodendroglioma -1.400 2.6e-09
psoriasis -1.100 2.6e-20

Gene RIF (3)

AA Sequence

MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEALQKMAKCAVQD      1 - 70
YTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAV     71 - 140
RGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITPRCGCVDPLPGRLPFHGYESACSGRHYCLRG    141 - 210
MDYYASGAPCTDRRLRPWCREQPTMCTSLRAPARNAVCCYNSPAVILPISEP                      211 - 262
//

Text Mined References (16)

PMID Year Title