Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.15
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 1.1e-06
ovarian cancer 8520 1.5e-05
osteosarcoma 7950 1.6e-03
medulloblastoma 720 2.1e-03
interstitial cystitis 2312 1.3e-02
urothelial carcinoma 318 1.5e-02
astrocytoma 1146 2.6e-02

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma -1.500 2.6e-02
ependymoma -1.200 1.1e-06
interstitial cystitis -1.400 1.3e-02
medulloblastoma -1.100 2.1e-03
osteosarcoma 1.289 1.6e-03
ovarian cancer 1.700 1.5e-05
urothelial carcinoma -1.900 1.5e-02

 Compartment GO Term (1)

AA Sequence

MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEF      1 - 70
QQQLGEAPSDASP                                                              71 - 83
//

Text Mined References (15)

PMID Year Title