Property Summary

NCBI Gene PubMed Count 8
PubMed Score 28.08
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (3)

AA Sequence

MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAE      1 - 70
DITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLA     71 - 140
AAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET          141 - 204
//

Text Mined References (20)

PMID Year Title