Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.60
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 5.3e-07
ependymoma 4679 6.4e-06
medulloblastoma, large-cell 6241 7.5e-04
invasive ductal carcinoma 2951 1.7e-02
Disease Target Count Z-score Confidence
Bardet-Biedl syndrome 51 3.571 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.800 6.4e-06
invasive ductal carcinoma 1.100 1.7e-02
medulloblastoma, large-cell -1.200 7.5e-04
nasopharyngeal carcinoma -1.400 5.3e-07

Protein-protein Interaction (1)

AA Sequence

MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTV      1 - 70
HEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD         71 - 136
//

Text Mined References (8)

PMID Year Title