Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.05
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.000 3.4e-11
medulloblastoma, large-cell -1.200 7.5e-04
nasopharyngeal carcinoma -1.900 4.7e-07
invasive ductal carcinoma 1.100 1.7e-02

Synonym

Accession Q5BN46 Q5T897 Q8WU44
Symbols PIERCE1
RbEST47

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTV      1 - 70
HEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD         71 - 136
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18182857 2007 Identification of a novel Rb-regulated gene associated with the cell cycle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.