Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.90
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 0.0e+00
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.300 0.0e+00

Synonym

Accession C9JRZ8 C9J3V2
Symbols AKR1B10L
AKR1R1B7
AKR1B10L, AK1R1B7

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MATFVELSTKAKMPIVGLGTWRSLLGKVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMR      1 - 70
EDLFIVSKVWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKTGDDFFPKDDKGNMISGKGTFLD     71 - 140
AWEAMEELVDEGLVKALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY    141 - 210
SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQVFDFK    211 - 280
LSDEEMATILSFNRNWRAFDFKEFSHLEDFPFDAEY                                      281 - 316
//

Text Mined References (10)

PMID Year Title