Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.10
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.300 0.000

Synonym

Accession C9JRZ8 C9J3V2
Symbols AKR1B10L
AKR1R1B7
AKR1B10L, AK1R1B7

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
26222439 Amino acid substitutions clustered in loops A and C result in a smaller more hydrophobic and more rigid active site in AKR1B15 compared with the AKR1B10 pocket, consistent with distinct substrate specificity and narrower inhibitor selectivity for AKR1B15.
25577493 AKR1B15.2 localizes to the cytosol and displays no enzymatic activity with the substrates tested.
22970857 human sperm possess an aldo-keto reductase on their membrane surface and are thus enzymatically protected against reactive aldehyde species both in the male and female reproductive tract
22277967 Strong candidate gene for mitochondrial disease, based on recessive mutations detected in infantile patients
21276782 AKR1B15 and Akr1b16 genes are expressed as functional proteins in human and murine tissues
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATFVELSTKAKMPIVGLGTWRSLLGKVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMR      1 - 70
EDLFIVSKVWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKTGDDFFPKDDKGNMISGKGTFLD     71 - 140
AWEAMEELVDEGLVKALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY    141 - 210
SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQVFDFK    211 - 280
LSDEEMATILSFNRNWRAFDFKEFSHLEDFPFDAEY                                      281 - 316
//

Text Mined References (10)

PMID Year Title
26222439 2015 Substrate Specificity, Inhibitor Selectivity and Structure-Function Relationships of Aldo-Keto Reductase 1B15: A Novel Human Retinaldehyde Reductase.
25577493 2015 Aldo-keto Reductase 1B15 (AKR1B15): a mitochondrial human aldo-keto reductase with activity toward steroids and 3-keto-acyl-CoA conjugates.
22970857 2013 Identification of a role for a mouse sperm surface aldo-keto reductase (AKR1B7) and its human analogue in the detoxification of the reactive aldehyde, acrolein.
22277967 2012 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
21276782 2011 Functional expression of novel human and murine AKR1B genes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.