Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.86
PubTator Score 4.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Nemaline myopathy 6 1 0.0 0.0
Disease Target Count
Nemaline Myopathy, Childhood Onset 6
Disease Target Count P-value
psoriasis 6694 9.3e-04
Disease Target Count Z-score Confidence
Nemaline myopathy 17 5.927 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 9.3e-04

Gene RIF (2)

AA Sequence

MARGPQTLVQVWVGGQLFQADRALLVEHCGFFRGLFRSGMRETRAAEVRLGVLSAGGFRATLQVLRGDRP      1 - 70
ALAAEDELLQAVECAAFLQAPALARFLEHNLTSDNCALLCDAAAAFGLRDVFHSAALFICDGERELAAEL     71 - 140
ALPEARAYVAALRPSSYAAVSTHTPAPGFLEDASRTLCYLDEEEDAWRTLAALPLEASTLLAGVATLGNK    141 - 210
LYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIGGEFQRTPISSVERYDP    211 - 280
AAGCWSFVADLPQPAAGVPCAQACGRLFVCLWRPADTTAVVEYAVRTDAWLPVAELRRPQSYGHCMVAHR    281 - 350
DSLYVVRNGPSDDFLHCAIDCLNLATGQWTALPGQFVNSKGALFTAVVRGDTVYTVNRMFTLLYAIEGGT    351 - 420
WRLLREKAGFPRPGSLQTFLLRLPPGAPGPVTSTTAEL                                    421 - 458
//

Text Mined References (7)

PMID Year Title