Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Influenza 142 5.104 2.6

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHHVVWSLFNTLFMNP      1 - 70
CCLGFIAFAYSVKSRDRKMVGNVTGAQAYASTTKCLNIWALILGILMTILLIIIPVLIFQAHR            71 - 133
//

Text Mined References (1)

PMID Year Title