Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Influenza 142 4.785 2.4

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHHVVWSLFNTLFMNP      1 - 70
CCLGFIAFAYSVKSRDRKMVGNVTGAQAYASTTKCLNIWALILGILMTILLIIIPVLIFQAHR            71 - 133
//

Text Mined References (1)

PMID Year Title
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.