Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.55
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.7
Disease Target Count Z-score Confidence
Atopic dermatitis 952 3.857 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 2.400 4.2e-07
group 4 medulloblastoma -1.100 2.9e-03
lung adenocarcinoma -1.800 3.0e-10
nasopharyngeal carcinoma -2.700 8.2e-07
non-small cell lung carcinoma -1.200 8.3e-08
ovarian cancer -1.600 1.5e-07

Gene RIF (4)

AA Sequence

MNMPVNKSPMINTCGGISSPYHEELWKLNFQHLSGERGHKSRPTFSITKEFILRFNQTQNSKEKEELLEL      1 - 70
ARKIILRCKRKLGLKTLGSGRHVHLPAAWTEVIYLAQCKGEIQDESLNMLYASLDHASFDYDHLPALFFV     71 - 140
AESVLYRLCCDASLKTYLYSVEIKLAKIGYLVFLRLFIFFLHGHLESFKQHLLRLQPYLYALSFSGASYH    141 - 210
KYPNIFSNVQFILKASEIIGKRELRSESIFRPVEDKKRYENTDSDMGGYEINHLLWHCVAAWSCVQNNSP    211 - 280
QLNNVLEHLVFHKTQLQKKCWLDSVLALLVLGEAAKLNMACLKALMDVVRDFVSSIMSVQNQEESCKVDD    281 - 350
FSWAWNVVYIYTVILAEICLYAATSDLRKTALIGFCHCKSSQKNILYLDKSVPPELKETSILSLLEYFSS    351 - 420
KMSENCDQVVWTGYYGLVYNLVKISWELQGDEEQDGLRNMIWQTLQKTKDYEEDVRIQNAINIAQAELND    421 - 490
PTDPFTRYSTNISSNVGEEVFSKYIGWRIANTLSKLFFPPIEAHFLPLKKPSIKKDQTKYPNKKLESVKK    491 - 560
QVLHFTVREHPSVSEIPMFPYPDFFTKADKELAKIIDHHWQEELKIREKEDAICKAQELKDKKLAEKNHF    561 - 630
QEVMKKREEKLHKQTKPYELPYRKEVI                                               631 - 657
//

Text Mined References (11)

PMID Year Title