Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.77989078204032E-10


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000


Accession C9JN71


  Ortholog (2)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG

AA Sequence

SNSFLYHERIHTGEKPYECKQCGKAFRSASILQKHVRTHAG                                 491 - 531

Text Mined References (2)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.