Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.36
PubTator Score 0.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession C9JLW8 Q6ZUL0
Symbols GRAN2
MCRIP
FAM195B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKV      1 - 70
PNPSLKTFKPIDLSDLKRRSTQDAKKS                                                71 - 97
//

Text Mined References (11)

PMID Year Title