Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.36
PubTator Score 0.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession C9JLW8 Q6ZUL0
Symbols GRAN2
MCRIP
FAM195B

Gene

PANTHER Protein Class (3)

Gene RIF (1)

PMID Text
25728771 MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP.

AA Sequence

MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKV      1 - 70
PNPSLKTFKPIDLSDLKRRSTQDAKKS                                                71 - 97
//

Text Mined References (11)

PMID Year Title
26184334 2015 Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins.
25728771 2015 MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...