Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 5.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession C9JLR9 A6NLS7 Q3C1V4
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (3)

PMID Text
25388523 C11orf95-RELA fusion transcript is thought to be the driver genetic alteration leading to activation of the NFkB pathway in supratentorial ependymomas.
24562983 C11orf95-RELA fusions represent a unique novel mechanism leading to pathological activation of NF-kappaB signaling in supratentorial ependymomas.
23672313 Based on a recurrent translocation t(11;16)(q13;p13), the C11orf95-MKL2 fusion gene has been found in eight further cases of chondroid lipomas.

AA Sequence

MEPGGDHRSRSSGGRGGPGPAVASARGRRLPPAGSSGSAEPEEDEGGQDLQLEGGALGSWGSAPLPSSRA      1 - 70
RGPASSGRKYSDHCEARASRPGKSRIPGRDHRRYYHDHWRLEYLMDFNPARHGMVCMVCGSSLATLKLST     71 - 140
IKRHIRQKHPYSLHWSPREKEVISNSWDAHLGLGACGEAEGLGVQGAEEEEEEEEEEEEEGAGVPACPPK    141 - 210
GPGKAPAGGGCRRQRRGGPVAPRARRLRLSASRRAGGSRGLGARRLERRLKESLQNWFRAECLMDYDPRG    211 - 280
NRLVCMACGRALPSLHLDDIRAHVLEVHPGSLGLSGPQRSALLQAWGGQPEALSELTQSPPGDDLAPQDL    281 - 350
TGKSRDSASAAGAPSSQDLSPPDVKEEAGWVPERPGPAEEEEELEEGEGERAGVPGRSPRGRAHRRHPQE    351 - 420
RWRLEYLMELDGGRRGLVCGVCGGALASLKMSTIERHIRRRHPGSTRLGGPVQALIAREWSEKAAHLLAL    421 - 490
GPPRPESPQGPIPPGTAAASDEGGGDEEEEPEEEEEEWGDVPLSPGAPLERPAEEEEDEEDGQEPGGLAL    491 - 560
PPPPPPPPPPPPRSREQRRNYQPRWRGEYLMDYDGSRRGLVCMVCGGALATLKVSTIKRHILQVHPFSMD    561 - 630
FTPEERQTILEAYEEAALRCYGHEGFGPPAPAPRDGGADLKSGAVCRA                          631 - 678
//

Text Mined References (9)

PMID Year Title
25388523 2015 C11orf95-RELA fusion present in a primary supratentorial ependymoma and recurrent sarcoma.
24562983 2014 Supratentorial ependymomas of childhood carry C11orf95-RELA fusions leading to pathological activation of the NF-?B signaling pathway.
24553141 2014 C11orf95-RELA fusions drive oncogenic NF-?B signalling in ependymoma.
23672313 2013 Presence of C11orf95-MKL2 fusion is a consistent finding in chondroid lipomas: a study of eight cases.
21274402 2011 Contributions of cytogenetics and molecular cytogenetics to the diagnosis of adipocytic tumors.
20607705 2010 C11orf95-MKL2 is the resulting fusion oncogene of t(11;16)(q13;p13) in chondroid lipoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.