Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 5.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.80071145209529E-11
osteosarcoma 7933 6.09703401532534E-7
malignant mesothelioma 3163 1.44590046550001E-6
medulloblastoma 1524 1.62427500676873E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 3.1216507814392E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.11704728086797E-4
psoriasis 6685 0.0010672283733197
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00129043054328752
gastric carcinoma 832 0.0310726557904908
Disease Target Count
benign ependymoma 2

Expression

  Differential Expression (9)

Gene RIF (3)

PMID Text
25388523 C11orf95-RELA fusion transcript is thought to be the driver genetic alteration leading to activation of the NFkB pathway in supratentorial ependymomas.
24562983 C11orf95-RELA fusions represent a unique novel mechanism leading to pathological activation of NF-kappaB signaling in supratentorial ependymomas.
23672313 Based on a recurrent translocation t(11;16)(q13;p13), the C11orf95-MKL2 fusion gene has been found in eight further cases of chondroid lipomas.

AA Sequence

MEPGGDHRSRSSGGRGGPGPAVASARGRRLPPAGSSGSAEPEEDEGGQDLQLEGGALGSWGSAPLPSSRA      1 - 70
RGPASSGRKYSDHCEARASRPGKSRIPGRDHRRYYHDHWRLEYLMDFNPARHGMVCMVCGSSLATLKLST     71 - 140
IKRHIRQKHPYSLHWSPREKEVISNSWDAHLGLGACGEAEGLGVQGAEEEEEEEEEEEEEGAGVPACPPK    141 - 210
GPGKAPAGGGCRRQRRGGPVAPRARRLRLSASRRAGGSRGLGARRLERRLKESLQNWFRAECLMDYDPRG    211 - 280
NRLVCMACGRALPSLHLDDIRAHVLEVHPGSLGLSGPQRSALLQAWGGQPEALSELTQSPPGDDLAPQDL    281 - 350
TGKSRDSASAAGAPSSQDLSPPDVKEEAGWVPERPGPAEEEEELEEGEGERAGVPGRSPRGRAHRRHPQE    351 - 420
RWRLEYLMELDGGRRGLVCGVCGGALASLKMSTIERHIRRRHPGSTRLGGPVQALIAREWSEKAAHLLAL    421 - 490
GPPRPESPQGPIPPGTAAASDEGGGDEEEEPEEEEEEWGDVPLSPGAPLERPAEEEEDEEDGQEPGGLAL    491 - 560
PPPPPPPPPPPPRSREQRRNYQPRWRGEYLMDYDGSRRGLVCMVCGGALATLKVSTIKRHILQVHPFSMD    561 - 630
FTPEERQTILEAYEEAALRCYGHEGFGPPAPAPRDGGADLKSGAVCRA                          631 - 678
//

Text Mined References (9)

PMID Year Title
25388523 2015 C11orf95-RELA fusion present in a primary supratentorial ependymoma and recurrent sarcoma.
24562983 2014 Supratentorial ependymomas of childhood carry C11orf95-RELA fusions leading to pathological activation of the NF-?B signaling pathway.
24553141 2014 C11orf95-RELA fusions drive oncogenic NF-?B signalling in ependymoma.
23672313 2013 Presence of C11orf95-MKL2 fusion is a consistent finding in chondroid lipomas: a study of eight cases.
21274402 2011 Contributions of cytogenetics and molecular cytogenetics to the diagnosis of adipocytic tumors.
20607705 2010 C11orf95-MKL2 is the resulting fusion oncogene of t(11;16)(q13;p13) in chondroid lipoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.