Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 5.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric carcinoma 1.100 3.1e-02
group 3 medulloblastoma 1.400 9.5e-03
intraductal papillary-mucinous adenoma (... -1.800 3.1e-06
intraductal papillary-mucinous carcinoma... -1.600 6.1e-04
intraductal papillary-mucinous neoplasm ... -1.700 1.3e-03
malignant mesothelioma 1.200 1.4e-06
osteosarcoma 1.753 6.1e-07
ovarian cancer -2.400 2.8e-11
psoriasis -1.300 1.1e-03

Gene RIF (3)

AA Sequence

MEPGGDHRSRSSGGRGGPGPAVASARGRRLPPAGSSGSAEPEEDEGGQDLQLEGGALGSWGSAPLPSSRA      1 - 70
RGPASSGRKYSDHCEARASRPGKSRIPGRDHRRYYHDHWRLEYLMDFNPARHGMVCMVCGSSLATLKLST     71 - 140
IKRHIRQKHPYSLHWSPREKEVISNSWDAHLGLGACGEAEGLGVQGAEEEEEEEEEEEEEGAGVPACPPK    141 - 210
GPGKAPAGGGCRRQRRGGPVAPRARRLRLSASRRAGGSRGLGARRLERRLKESLQNWFRAECLMDYDPRG    211 - 280
NRLVCMACGRALPSLHLDDIRAHVLEVHPGSLGLSGPQRSALLQAWGGQPEALSELTQSPPGDDLAPQDL    281 - 350
TGKSRDSASAAGAPSSQDLSPPDVKEEAGWVPERPGPAEEEEELEEGEGERAGVPGRSPRGRAHRRHPQE    351 - 420
RWRLEYLMELDGGRRGLVCGVCGGALASLKMSTIERHIRRRHPGSTRLGGPVQALIAREWSEKAAHLLAL    421 - 490
GPPRPESPQGPIPPGTAAASDEGGGDEEEEPEEEEEEWGDVPLSPGAPLERPAEEEEDEEDGQEPGGLAL    491 - 560
PPPPPPPPPPPPRSREQRRNYQPRWRGEYLMDYDGSRRGLVCMVCGGALATLKVSTIKRHILQVHPFSMD    561 - 630
FTPEERQTILEAYEEAALRCYGHEGFGPPAPAPRDGGADLKSGAVCRA                          631 - 678
//

Text Mined References (12)

PMID Year Title