Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.28
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

AA Sequence

MLGFLSRGPSMKLCMGLACVLSLWNTVSGIKGEAKKEKGMTFLPTTVSGLREEERKEKGVAFLATTELPA      1 - 70
RSIDLSALNLTELVNGMLSRALKDSKKFFSLLSVTSYSSFAFHKFSVAVYNISNLKTVDPAKFPTRYCYC     71 - 140
LNNRTNDLSDFTALLVDIIGNSTSYLTEIFKSTSILSVNQSNESDCIFICVMTGKSGRNLSDFWEIEEKY    141 - 210
PIINYTFTSGLSGVLGAATRGTARTSKPTTKSQKTLPSTSPGHWTQSTPWASALRSSPWTETAAPSETEE    211 - 280
TLNTGRPPELPARATATWFSASHTLPALATRRVARTQWLTADRQTWASISSVPWAQTISEKKPGGSLWET    281 - 350
RSSPPTTAGTEEAMNTTSLLAPAAEIMATPGSPSQASPTLGAFTHGTQTPSPTKATAPRYPQTGDLSAEW    351 - 420
PFTAGEEPVLVPRPHQVSRCPQPLFKVGAMAAAPLTLAIQRLNPCLMELCQFFQQCLCMSQRSPRTEDMR    421 - 490
YCLEYYSWFLKNATYICQRVKRVSHSHTLKQKCLENICKSV                                 491 - 531
//

Text Mined References (5)

PMID Year Title
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
16421571 2006 DNA sequence and analysis of human chromosome 8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10329003 1999 Intergenic splicing between a HERV-H endogenous retrovirus and two adjacent human genes.
8382789 1993 Splicing of a human endogenous retrovirus to a novel phospholipase A2 related gene.