Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 6.59844557388085E-12
ovarian cancer 8492 3.70858985716898E-9
tuberculosis and treatment for 3 months 327 6.9153056275128E-7
atypical teratoid / rhabdoid tumor 4369 9.19595793234713E-6
pilocytic astrocytoma 3086 2.04530848718342E-5
adult high grade glioma 2148 3.78720216424496E-5
glioblastoma 5572 4.66326568212538E-5
medulloblastoma, large-cell 6234 2.47282368276807E-4
primitive neuroectodermal tumor 3031 2.80676606443361E-4
gastric carcinoma 832 0.00699455673900929
subependymal giant cell astrocytoma 2287 0.0159987396476063

Expression

AA Sequence

MEPLGLVVHGKAEPFSAALRSLVNNPRYSDVCFVVGQERQEVFAHRCLLACRCNFFQRLLGTEPGPGVPS      1 - 70
PVVLSTVPTEAFLAVLEFLYTNSVKLYRHSVLEVLTAAVEYGLEELRELCLQFVVKVLDVDLVCEALQVA     71 - 140
VTFGLGQLQERCVAFIEAHSQEALRTRGFLELSAAALLPLLRSDKLCVDEAELVRAARSWARVGAAVLER    141 - 210
PVAEVAAPVVKELRLALLAPAELSALEEQNRQEPLIPVEQIVEAWKCHALRRGDEARGAPCRRRRGTLPR    211 - 280
EHHRFLDLSFK                                                               281 - 291
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.