Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.800 3.8e-05
Astrocytoma, Pilocytic 1.300 1.2e-05
atypical teratoid / rhabdoid tumor 2.000 9.2e-06
ependymoma 2.100 1.2e-10
gastric carcinoma 1.600 7.0e-03
glioblastoma 1.500 3.8e-07
medulloblastoma, large-cell 1.100 2.5e-04
ovarian cancer -1.200 3.7e-09
primitive neuroectodermal tumor 1.100 2.8e-04
subependymal giant cell astrocytoma 1.935 1.6e-02
tuberculosis -2.500 1.2e-05

AA Sequence

MEPLGLVVHGKAEPFSAALRSLVNNPRYSDVCFVVGQERQEVFAHRCLLACRCNFFQRLLGTEPGPGVPS      1 - 70
PVVLSTVPTEAFLAVLEFLYTNSVKLYRHSVLEVLTAAVEYGLEELRELCLQFVVKVLDVDLVCEALQVA     71 - 140
VTFGLGQLQERCVAFIEAHSQEALRTRGFLELSAAALLPLLRSDKLCVDEAELVRAARSWARVGAAVLER    141 - 210
PVAEVAAPVVKELRLALLAPAELSALEEQNRQEPLIPVEQIVEAWKCHALRRGDEARGAPCRRRRGTLPR    211 - 280
EHHRFLDLSFK                                                               281 - 291
//

Text Mined References (2)

PMID Year Title