Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
ADULT syndrome 9 4.992 2.5

Expression

AA Sequence

MAAAPAVCASQGSPPGAPSAPAAAPAPAAGLGRCRMALLLAVALDVAGMAALLTGVFAQLQVRGRDFGDL      1 - 70
LIYSGALLVFLSLLGWILWYTGNIEISRQELERDYGLRPSALARLARKLSRRWSAPAAAGQRPAPGSRRA     71 - 140
RRAARAPPPPAAGSRRVRLQLATLEAGPGAAGAGSE                                      141 - 176
//

Text Mined References (4)

PMID Year Title