Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ADULT syndrome 9 4.994 2.5

Expression

AA Sequence

MAAAPAVCASQGSPPGAPSAPAAAPAPAAGLGRCRMALLLAVALDVAGMAALLTGVFAQLQVRGRDFGDL      1 - 70
LIYSGALLVFLSLLGWILWYTGNIEISRQELERDYGLRPSALARLARKLSRRWSAPAAAGQRPAPGSRRA     71 - 140
RRAARAPPPPAAGSRRVRLQLATLEAGPGAAGAGSE                                      141 - 176
//

Text Mined References (4)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.