Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 2.1e-02

Synonym

Accession C9JDV5
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MIPKLATPRDISLLVIKEASSRARNNIQILDPLDHIARLTNYTLTSCFSSNKVPTMPGSLPTGSKQGNVQ      1 - 70
TLDSIRWMPATPVPAPECHQKYAISTETAFPTLSTFMNTEKSVKGSNADFTKRNPRWRFLLGIYCSLHHA     71 - 140
MTIFI                                                                     141 - 145
//

Text Mined References (3)

PMID Year Title