Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

AA Sequence

MAWSFRAKVQLGGLLLSLLGWVCSCVTTILPQWKTLNLELNEMETWIMGIWEVCVDREEVATVCKAFESF      1 - 70
LSLPQELQVARILMVASHGLGLLGLLLCSFGSECFQFHRIRWVFKRRLGLLGRTLEASASATTLLPVSWV     71 - 140
AHATIQDFWDDSIPDIIPRWEFGGALYLGWAAGIFLALGGLLLIFSACLGKEDVPFPLMAGPTVPLSCAP    141 - 210
VEESDGSFHLMLRPRNLVI                                                       211 - 229
//

Text Mined References (5)

PMID Year Title
19706201 2009 The claudins.
18036336 2008 Structure and function of claudins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
11181995 2001 The sequence of the human genome.