Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MAWSFRAKVQLGGLLLSLLGWVCSCVTTILPQWKTLNLELNEMETWIMGIWEVCVDREEVATVCKAFESF      1 - 70
LSLPQELQVARILMVASHGLGLLGLLLCSFGSECFQFHRIRWVFKRRLGLLGRTLEASASATTLLPVSWV     71 - 140
AHATIQDFWDDSIPDIIPRWEFGGALYLGWAAGIFLALGGLLLIFSACLGKEDVPFPLMAGPTVPLSCAP    141 - 210
VEESDGSFHLMLRPRNLVI                                                       211 - 229
//

Text Mined References (5)

PMID Year Title