Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.72628673805843E-7
ulcerative colitis 2087 2.2053994653502E-6
group 4 medulloblastoma 1875 1.82369654056216E-5
medulloblastoma, large-cell 6234 7.50378387974503E-5
glioblastoma 5572 0.00349987362070917
adult high grade glioma 2148 0.0059963302344042
spina bifida 1064 0.0345855386838441

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.996 0.000
glioblastoma -1.100 0.003
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.500 0.000
adult high grade glioma -1.100 0.006
spina bifida -1.780 0.035
ulcerative colitis -1.200 0.000

AA Sequence

MDVRGPEAPGGRALRDAAENLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVKDLMVQAGIENSIKEQ      1 - 70
MLKT                                                                       71 - 74
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.