Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 6.0e-03
glioblastoma -1.100 3.5e-03
group 4 medulloblastoma -1.600 1.8e-05
medulloblastoma, large-cell -1.500 7.5e-05
osteosarcoma -1.996 3.7e-07
spina bifida -1.780 3.5e-02
ulcerative colitis -1.200 2.2e-06

AA Sequence

MDVRGPEAPGGRALRDAAENLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVKDLMVQAGIENSIKEQ      1 - 70
MLKT                                                                       71 - 74
//

Text Mined References (5)

PMID Year Title