Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.33

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.86311518044527E-26


Accession C9JC47


 Compartment GO Term (1)

AA Sequence

HEGRVNLVFFIGSPTVIAVPDLQCPTKYSGMLY                                         351 - 383

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.