Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
inflammatory breast cancer 286 9.6e-03
Disease Target Count Z-score Confidence
Severe pre-eclampsia 3 3.098 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer -1.100 9.6e-03

AA Sequence

MMTAVSLTTRPQESVAFEDVAVYFTTKEWAIMVPAERALYRDVMLENYEAVAFVVPPTSKPALVSHLEQG      1 - 70
KESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQCWEDRRKA                 71 - 128
//

Text Mined References (7)

PMID Year Title