Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.7e-08

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -2.000 7.7e-08

AA Sequence

MTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTIT      1 - 70
DLPDHLLSYDGSENLSRFWYDFTLENSVLCDS                                           71 - 102
//

Text Mined References (8)

PMID Year Title