Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 7.69759525448888E-8


AA Sequence

DLPDHLLSYDGSENLSRFWYDFTLENSVLCDS                                           71 - 102

Text Mined References (8)

PMID Year Title
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21221126 2012 Genome-wide association study of serious blistering skin rash caused by drugs.
21216879 2011 A genome-wide association study identifies novel loci associated with circulating IGF-I and IGFBP-3.
20448139 2010 UMA and MABP domains throw light on receptor endocytosis and selection of endosomal cargoes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.