Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 2.100 0.001

Synonym

Accession C9J6K1
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MQPEVEPVCFPAMGSPTMHRKAGALLMDLETPEEMQARSLGRPIKSSKQYLRQVIAEYEALDRELPCIRK      1 - 70
FPTPPASQPLCLCMETLPEEDFTHLEVLQALEAQLPGAMESGRVSSIRFENMNVICGTAGRRNRWLIAVT     71 - 140
DFQTRSRLLRSGLSPRGLAHQIVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPNEEA                141 - 198
//

Text Mined References (1)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.