Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.082 5.5e-05

AA Sequence

MLLSLLGACAVVGPFHGPEWEPVQGLLSQNHSCRDPQCCGNLLVLCLFLVWQVRHCWHQVTRTRFSTRNV      1 - 70
IKVPLQKRAVPSMRCETVFKLTPEFFSPGKSRGLDSQQCAQRQRWGYRRSLQESWAQNLLSPQHPCPGPP     71 - 140
SGVHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVI    141 - 210
SVRSRPTSMTLTTSLPNLLSAERLQFCPQRAPA                                         211 - 243
//

Text Mined References (5)

PMID Year Title