Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession C9J3V5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MDSRKLSPRGKKLESHLSQEHRRPPLGLIAAWGQPSIQSSVQQGLQTQDWVCEPPERRRPGRRWSVSIDE      1 - 70
RRRLATLGGRERPGAAGTQLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNA     71 - 140
TFEASRSPPS                                                                141 - 150
//

Text Mined References (2)

PMID Year Title