Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000
non primary Sjogren syndrome sicca -1.300 0.030
ovarian cancer 1.500 0.000

Synonym

Accession C9J3I9
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MREIAEILPAQEKVEARIDLKMGKKRVTDHKLNVDKVIKNINTISSELKKIKELSQLLLCDLILHFNHPI      1 - 70
KTENLAEAERNNPLFEESKISDVSLVSNSFSI                                           71 - 102
//

Text Mined References (4)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.